Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2847625..2848262 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0DMV7 |
Locus tag | MBS3601_RS13200 | Protein ID | WP_003413180.1 |
Coordinates | 2847625..2848020 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ44 |
Locus tag | MBS3601_RS13205 | Protein ID | WP_003413183.1 |
Coordinates | 2848017..2848262 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS13160 | 2843710..2844369 | + | 660 | WP_003900846.1 | LppA family lipoprotein | - |
MBS3601_RS13165 | 2844366..2845025 | + | 660 | WP_003900847.1 | hypothetical protein | - |
MBS3601_RS13170 | 2845022..2845684 | + | 663 | WP_003900848.1 | hypothetical protein | - |
MBS3601_RS13175 | 2845681..2845959 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
MBS3601_RS13180 | 2846052..2846465 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
MBS3601_RS13185 | 2846504..2846761 | + | 258 | WP_003413167.1 | ribbon-helix-helix domain-containing protein | - |
MBS3601_RS13190 | 2846758..2847135 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
MBS3601_RS13195 | 2847151..2847525 | - | 375 | WP_003413177.1 | hypothetical protein | - |
MBS3601_RS13200 | 2847625..2848020 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | Toxin |
MBS3601_RS13205 | 2848017..2848262 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | Antitoxin |
MBS3601_RS13210 | 2848673..2849092 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
MBS3601_RS13215 | 2849104..2849931 | - | 828 | WP_010950736.1 | shikimate dehydrogenase | - |
MBS3601_RS13220 | 2849909..2851162 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
MBS3601_RS13225 | 2851155..2851667 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14619.53 Da Isoelectric Point: 6.9794
>T288852 WP_003413180.1 NZ_LR699570:c2848020-2847625 [Mycobacterium tuberculosis variant bovis]
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5WZ4 | |
PDB | 5WZF |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW31 |