Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 2846052..2846761 | Replicon | chromosome |
| Accession | NZ_LR699570 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ26 |
| Locus tag | MBS3601_RS13180 | Protein ID | WP_003413164.1 |
| Coordinates | 2846052..2846465 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P95006 |
| Locus tag | MBS3601_RS13185 | Protein ID | WP_003413167.1 |
| Coordinates | 2846504..2846761 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MBS3601_RS13150 | 2841762..2842076 | + | 315 | WP_009937839.1 | hypothetical protein | - |
| MBS3601_RS13155 | 2842372..2843583 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
| MBS3601_RS13160 | 2843710..2844369 | + | 660 | WP_003900846.1 | LppA family lipoprotein | - |
| MBS3601_RS13165 | 2844366..2845025 | + | 660 | WP_003900847.1 | hypothetical protein | - |
| MBS3601_RS13170 | 2845022..2845684 | + | 663 | WP_003900848.1 | hypothetical protein | - |
| MBS3601_RS13175 | 2845681..2845959 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| MBS3601_RS13180 | 2846052..2846465 | + | 414 | WP_003413164.1 | PIN domain nuclease | Toxin |
| MBS3601_RS13185 | 2846504..2846761 | + | 258 | WP_003413167.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| MBS3601_RS13190 | 2846758..2847135 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
| MBS3601_RS13195 | 2847151..2847525 | - | 375 | WP_003413177.1 | hypothetical protein | - |
| MBS3601_RS13200 | 2847625..2848020 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
| MBS3601_RS13205 | 2848017..2848262 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
| MBS3601_RS13210 | 2848673..2849092 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
| MBS3601_RS13215 | 2849104..2849931 | - | 828 | WP_010950736.1 | shikimate dehydrogenase | - |
| MBS3601_RS13220 | 2849909..2851162 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
| MBS3601_RS13225 | 2851155..2851667 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15045.00 Da Isoelectric Point: 5.4673
>T288850 WP_003413164.1 NZ_LR699570:2846052-2846465 [Mycobacterium tuberculosis variant bovis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ26 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C9W5 |