288850

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2846052..2846761 Replicon chromosome
Accession NZ_LR699570
Organism Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag MBS3601_RS13180 Protein ID WP_003413164.1
Coordinates 2846052..2846465 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag MBS3601_RS13185 Protein ID WP_003413167.1
Coordinates 2846504..2846761 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MBS3601_RS13150 2841762..2842076 + 315 WP_009937839.1 hypothetical protein -
MBS3601_RS13155 2842372..2843583 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
MBS3601_RS13160 2843710..2844369 + 660 WP_003900846.1 LppA family lipoprotein -
MBS3601_RS13165 2844366..2845025 + 660 WP_003900847.1 hypothetical protein -
MBS3601_RS13170 2845022..2845684 + 663 WP_003900848.1 hypothetical protein -
MBS3601_RS13175 2845681..2845959 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
MBS3601_RS13180 2846052..2846465 + 414 WP_003413164.1 PIN domain nuclease Toxin
MBS3601_RS13185 2846504..2846761 + 258 WP_003413167.1 ribbon-helix-helix domain-containing protein Antitoxin
MBS3601_RS13190 2846758..2847135 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
MBS3601_RS13195 2847151..2847525 - 375 WP_003413177.1 hypothetical protein -
MBS3601_RS13200 2847625..2848020 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
MBS3601_RS13205 2848017..2848262 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
MBS3601_RS13210 2848673..2849092 - 420 WP_003413190.1 A24 family peptidase -
MBS3601_RS13215 2849104..2849931 - 828 WP_010950736.1 shikimate dehydrogenase -
MBS3601_RS13220 2849909..2851162 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
MBS3601_RS13225 2851155..2851667 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T288850 WP_003413164.1 NZ_LR699570:2846052-2846465 [Mycobacterium tuberculosis variant bovis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT288850 WP_003413167.1 NZ_LR699570:2846504-2846761 [Mycobacterium tuberculosis variant bovis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References