Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2831509..2832149 Replicon chromosome
Accession NZ_LR699570
Organism Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag MBS3601_RS13090 Protein ID WP_003412970.1
Coordinates 2831509..2831928 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag MBS3601_RS13095 Protein ID WP_003412975.1
Coordinates 2831925..2832149 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MBS3601_RS13060 2827094..2827816 - 723 WP_156068489.1 DUF1906 domain-containing protein -
MBS3601_RS13065 2828333..2828560 + 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
MBS3601_RS13070 2828557..2828958 + 402 WP_003412963.1 PIN domain-containing protein -
MBS3601_RS13075 2828993..2829913 - 921 WP_011799273.1 restriction endonuclease -
MBS3601_RS13080 2830254..2830499 - 246 WP_071854223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
MBS3601_RS13085 2830558..2831508 + 951 WP_162305733.1 Lsr2 family protein -
MBS3601_RS13090 2831509..2831928 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
MBS3601_RS13095 2831925..2832149 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
MBS3601_RS13100 2832180..2835023 - 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
MBS3601_RS13105 2835095..2835496 - 402 WP_003412981.1 hypothetical protein -
MBS3601_RS13110 2835496..2835966 - 471 WP_003412985.1 transcription antitermination factor NusB -
MBS3601_RS13115 2835969..2836532 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T288849 WP_003412970.1 NZ_LR699570:c2831928-2831509 [Mycobacterium tuberculosis variant bovis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT288849 WP_003412975.1 NZ_LR699570:c2832149-2831925 [Mycobacterium tuberculosis variant bovis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References