Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2831509..2832149 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ08 |
Locus tag | MBS3601_RS13090 | Protein ID | WP_003412970.1 |
Coordinates | 2831509..2831928 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ09 |
Locus tag | MBS3601_RS13095 | Protein ID | WP_003412975.1 |
Coordinates | 2831925..2832149 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS13060 | 2827094..2827816 | - | 723 | WP_156068489.1 | DUF1906 domain-containing protein | - |
MBS3601_RS13065 | 2828333..2828560 | + | 228 | WP_003412960.1 | type II toxin-antitoxin system VapB family antitoxin | - |
MBS3601_RS13070 | 2828557..2828958 | + | 402 | WP_003412963.1 | PIN domain-containing protein | - |
MBS3601_RS13075 | 2828993..2829913 | - | 921 | WP_011799273.1 | restriction endonuclease | - |
MBS3601_RS13080 | 2830254..2830499 | - | 246 | WP_071854223.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
MBS3601_RS13085 | 2830558..2831508 | + | 951 | WP_162305733.1 | Lsr2 family protein | - |
MBS3601_RS13090 | 2831509..2831928 | - | 420 | WP_003412970.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MBS3601_RS13095 | 2831925..2832149 | - | 225 | WP_003412975.1 | antitoxin VapB39 | Antitoxin |
MBS3601_RS13100 | 2832180..2835023 | - | 2844 | WP_003899363.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
MBS3601_RS13105 | 2835095..2835496 | - | 402 | WP_003412981.1 | hypothetical protein | - |
MBS3601_RS13110 | 2835496..2835966 | - | 471 | WP_003412985.1 | transcription antitermination factor NusB | - |
MBS3601_RS13115 | 2835969..2836532 | - | 564 | WP_003412989.1 | elongation factor P | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14732.70 Da Isoelectric Point: 6.7519
>T288849 WP_003412970.1 NZ_LR699570:c2831928-2831509 [Mycobacterium tuberculosis variant bovis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|