Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2394315..2394844 Replicon chromosome
Accession NZ_LR699570
Organism Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag MBS3601_RS11065 Protein ID WP_003411124.1
Coordinates 2394315..2394632 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag MBS3601_RS11070 Protein ID WP_003411127.1
Coordinates 2394629..2394844 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MBS3601_RS11035 2389336..2390412 + 1077 WP_069523391.1 hypothetical protein -
MBS3601_RS11040 2390409..2390690 + 282 WP_019283661.1 hypothetical protein -
MBS3601_RS11045 2390726..2391799 + 1074 WP_011799246.1 quinone-dependent dihydroorotate dehydrogenase -
MBS3601_RS11050 2391804..2392334 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
MBS3601_RS11055 2392382..2393728 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
MBS3601_RS11065 2394315..2394632 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MBS3601_RS11070 2394629..2394844 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
MBS3601_RS11075 2395099..2396157 + 1059 WP_003411129.1 hypothetical protein -
MBS3601_RS11080 2396287..2396643 - 357 WP_003411130.1 hypothetical protein -
MBS3601_RS11085 2396738..2397520 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
MBS3601_RS11090 2397788..2398078 - 291 WP_003900476.1 YggT family protein -
MBS3601_RS11095 2398240..2398896 - 657 WP_003411133.1 cell division protein SepF -
MBS3601_RS11100 2398962..2399738 - 777 WP_003411137.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T288847 WP_003411124.1 NZ_LR699570:c2394632-2394315 [Mycobacterium tuberculosis variant bovis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT288847 WP_003411127.1 NZ_LR699570:c2394844-2394629 [Mycobacterium tuberculosis variant bovis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References