Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2245841..2246467 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64926 |
Locus tag | MBS3601_RS10385 | Protein ID | WP_003410075.1 |
Coordinates | 2246069..2246467 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | MBS3601_RS10380 | Protein ID | WP_019283586.1 |
Coordinates | 2245841..2246068 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS10370 | 2243880..2244224 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
MBS3601_RS10375 | 2244413..2245582 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
MBS3601_RS10380 | 2245841..2246068 | + | 228 | WP_019283586.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MBS3601_RS10385 | 2246069..2246467 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
MBS3601_RS10390 | 2246650..2247081 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
MBS3601_RS10395 | 2247182..2247616 | + | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
MBS3601_RS10400 | 2248053..2248232 | - | 180 | Protein_2055 | hypothetical protein | - |
MBS3601_RS10405 | 2248293..2248940 | + | 648 | WP_071854215.1 | transposase | - |
MBS3601_RS10410 | 2248894..2249484 | + | 591 | WP_003899131.1 | IS110 family transposase | - |
MBS3601_RS10415 | 2249612..2250868 | - | 1257 | WP_003410095.1 | HNH endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T288843 WP_003410075.1 NZ_LR699570:2246069-2246467 [Mycobacterium tuberculosis variant bovis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|