Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2222101..2222687 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLY3 |
Locus tag | MBS3601_RS10280 | Protein ID | WP_003410010.1 |
Coordinates | 2222101..2222445 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL58 |
Locus tag | MBS3601_RS10285 | Protein ID | WP_003410014.1 |
Coordinates | 2222439..2222687 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS10245 | 2217807..2218406 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
MBS3601_RS10250 | 2218822..2219250 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
MBS3601_RS10255 | 2219476..2220015 | + | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
MBS3601_RS10260 | 2220535..2221095 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | - |
MBS3601_RS10265 | 2221092..2221433 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | - |
MBS3601_RS10270 | 2221519..2221776 | + | 258 | WP_003410006.1 | hypothetical protein | - |
MBS3601_RS10275 | 2221677..2222012 | - | 336 | WP_003410009.1 | dehydrogenase | - |
MBS3601_RS10280 | 2222101..2222445 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | Toxin |
MBS3601_RS10285 | 2222439..2222687 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
MBS3601_RS10290 | 2222787..2225102 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
MBS3601_RS10295 | 2225099..2225371 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
MBS3601_RS10300 | 2225424..2225780 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
MBS3601_RS10305 | 2225937..2226704 | + | 768 | WP_003410019.1 | hemerythrin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12230.12 Da Isoelectric Point: 9.8887
>T288842 WP_003410010.1 NZ_LR699570:c2222445-2222101 [Mycobacterium tuberculosis variant bovis]
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5HK3 | |
PDB | 5HK0 | |
PDB | 5HKC |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FAW9 |