Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2204195..2204739 Replicon chromosome
Accession NZ_LR699570
Organism Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag MBS3601_RS10160 Protein ID WP_003409896.1
Coordinates 2204195..2204491 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag MBS3601_RS10165 Protein ID WP_003409899.1
Coordinates 2204488..2204739 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MBS3601_RS10105 2199228..2199578 - 351 WP_003409871.1 hypothetical protein -
MBS3601_RS10110 2199589..2200491 - 903 WP_003409874.1 hypothetical protein -
MBS3601_RS10115 2200512..2200703 - 192 WP_003409876.1 hypothetical protein -
MBS3601_RS10120 2200704..2201000 - 297 WP_003409877.1 hypothetical protein -
MBS3601_RS10125 2201240..2201455 + 216 WP_003409878.1 antitoxin -
MBS3601_RS10130 2201452..2201763 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
MBS3601_RS10135 2201737..2202258 - 522 WP_010950637.1 hypothetical protein -
MBS3601_RS10140 2202233..2202610 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
MBS3601_RS10145 2202652..2203101 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
MBS3601_RS10150 2203098..2203643 + 546 WP_003409891.1 SecB-like chaperone -
MBS3601_RS10155 2203532..2204146 - 615 WP_003901296.1 hypothetical protein -
MBS3601_RS10160 2204195..2204491 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MBS3601_RS10165 2204488..2204739 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
MBS3601_RS10170 2204726..2205220 + 495 WP_003899099.1 hypothetical protein -
MBS3601_RS10175 2205380..2205787 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
MBS3601_RS10180 2205791..2206063 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
MBS3601_RS10185 2206096..2207316 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
MBS3601_RS10190 2208215..2208520 + 306 Protein_2013 ABC transporter permease -
MBS3601_RS10195 2208704..2209552 + 849 WP_003409942.1 class I SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T288839 WP_003409896.1 NZ_LR699570:c2204491-2204195 [Mycobacterium tuberculosis variant bovis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT288839 WP_003409899.1 NZ_LR699570:c2204739-2204488 [Mycobacterium tuberculosis variant bovis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References