Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 2204195..2204739 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | parE | Uniprot ID | G0TLU9 |
Locus tag | MBS3601_RS10160 | Protein ID | WP_003409896.1 |
Coordinates | 2204195..2204491 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P67299 |
Locus tag | MBS3601_RS10165 | Protein ID | WP_003409899.1 |
Coordinates | 2204488..2204739 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS10105 | 2199228..2199578 | - | 351 | WP_003409871.1 | hypothetical protein | - |
MBS3601_RS10110 | 2199589..2200491 | - | 903 | WP_003409874.1 | hypothetical protein | - |
MBS3601_RS10115 | 2200512..2200703 | - | 192 | WP_003409876.1 | hypothetical protein | - |
MBS3601_RS10120 | 2200704..2201000 | - | 297 | WP_003409877.1 | hypothetical protein | - |
MBS3601_RS10125 | 2201240..2201455 | + | 216 | WP_003409878.1 | antitoxin | - |
MBS3601_RS10130 | 2201452..2201763 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
MBS3601_RS10135 | 2201737..2202258 | - | 522 | WP_010950637.1 | hypothetical protein | - |
MBS3601_RS10140 | 2202233..2202610 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | - |
MBS3601_RS10145 | 2202652..2203101 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | - |
MBS3601_RS10150 | 2203098..2203643 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
MBS3601_RS10155 | 2203532..2204146 | - | 615 | WP_003901296.1 | hypothetical protein | - |
MBS3601_RS10160 | 2204195..2204491 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MBS3601_RS10165 | 2204488..2204739 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
MBS3601_RS10170 | 2204726..2205220 | + | 495 | WP_003899099.1 | hypothetical protein | - |
MBS3601_RS10175 | 2205380..2205787 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
MBS3601_RS10180 | 2205791..2206063 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MBS3601_RS10185 | 2206096..2207316 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
MBS3601_RS10190 | 2208215..2208520 | + | 306 | Protein_2013 | ABC transporter permease | - |
MBS3601_RS10195 | 2208704..2209552 | + | 849 | WP_003409942.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11268.64 Da Isoelectric Point: 6.8604
>T288839 WP_003409896.1 NZ_LR699570:c2204491-2204195 [Mycobacterium tuberculosis variant bovis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TLU9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BUZ2 |