Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1959140..1959600 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A7U4FB26 |
Locus tag | MBS3601_RS09030 | Protein ID | WP_003408531.1 |
Coordinates | 1959352..1959600 (+) | Length | 83 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ30 |
Locus tag | MBS3601_RS09025 | Protein ID | WP_003408528.1 |
Coordinates | 1959140..1959352 (+) | Length | 71 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS09010 | 1955618..1956805 | - | 1188 | WP_003898992.1 | nitrate transporter NarK | - |
MBS3601_RS09015 | 1957092..1957376 | + | 285 | WP_003408522.1 | DUF1876 domain-containing protein | - |
MBS3601_RS09020 | 1957390..1959072 | - | 1683 | WP_003898994.1 | SulP family inorganic anion transporter | - |
MBS3601_RS09025 | 1959140..1959352 | + | 213 | WP_003408528.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MBS3601_RS09030 | 1959352..1959600 | + | 249 | WP_003408531.1 | hypothetical protein | Toxin |
MBS3601_RS09035 | 1959608..1960346 | + | 739 | Protein_1782 | hypothetical protein | - |
MBS3601_RS09040 | 1960440..1962140 | + | 1701 | WP_003898998.1 | serine/threonine protein kinase PknE | - |
MBS3601_RS09045 | 1962425..1962826 | - | 402 | WP_010950586.1 | hypothetical protein | - |
MBS3601_RS09050 | 1962897..1963427 | - | 531 | WP_011799212.1 | isopentenyl-diphosphate Delta-isomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 8857.07 Da Isoelectric Point: 3.9794
>T288836 WP_003408531.1 NZ_LR699570:1959352-1959600 [Mycobacterium tuberculosis variant bovis]
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVL
AG
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVL
AG
Download Length: 249 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FB26 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CFE8 |