Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1938524..1939137 | Replicon | chromosome |
| Accession | NZ_LR699570 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WFA2 |
| Locus tag | MBS3601_RS08920 | Protein ID | WP_003408465.1 |
| Coordinates | 1938524..1938913 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ52 |
| Locus tag | MBS3601_RS08925 | Protein ID | WP_003408469.1 |
| Coordinates | 1938910..1939137 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MBS3601_RS08890 | 1934154..1935068 | + | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
| MBS3601_RS08895 | 1935071..1935901 | + | 831 | WP_003408448.1 | cyclase family protein | - |
| MBS3601_RS08900 | 1935901..1936251 | + | 351 | WP_003898986.1 | cupin domain-containing protein | - |
| MBS3601_RS08905 | 1936304..1937121 | + | 818 | Protein_1757 | 3-keto-5-aminohexanoate cleavage protein | - |
| MBS3601_RS08910 | 1937135..1937914 | + | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
| MBS3601_RS08920 | 1938524..1938913 | - | 390 | WP_003408465.1 | PIN domain-containing protein | Toxin |
| MBS3601_RS08925 | 1938910..1939137 | - | 228 | WP_003408469.1 | antitoxin | Antitoxin |
| MBS3601_RS08930 | 1939355..1940839 | + | 1485 | WP_010950580.1 | biotin carboxylase | - |
| MBS3601_RS08935 | 1940836..1942083 | + | 1248 | WP_003408476.1 | serine hydrolase | - |
| MBS3601_RS08940 | 1942126..1942545 | - | 420 | WP_003408483.1 | hypothetical protein | - |
| MBS3601_RS08945 | 1942535..1943245 | - | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13817.98 Da Isoelectric Point: 7.0612
>T288835 WP_003408465.1 NZ_LR699570:c1938913-1938524 [Mycobacterium tuberculosis variant bovis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BUI9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7E4J | |
| AlphaFold DB | A0A7U4FAN9 |