Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1754934..1755547 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64880 |
Locus tag | MBS3601_RS08105 | Protein ID | WP_003407786.1 |
Coordinates | 1755143..1755547 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8UJ46 |
Locus tag | MBS3601_RS08100 | Protein ID | WP_009935474.1 |
Coordinates | 1754934..1755137 (+) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS08085 | 1750198..1753101 | + | 2904 | WP_156068443.1 | MMPL family transporter | - |
MBS3601_RS08090 | 1753111..1753557 | + | 447 | WP_003407780.1 | F420H(2)-dependent quinone reductase | - |
MBS3601_RS08095 | 1753592..1754881 | + | 1290 | WP_003407781.1 | threonine ammonia-lyase | - |
MBS3601_RS08100 | 1754934..1755137 | + | 204 | WP_009935474.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MBS3601_RS08105 | 1755143..1755547 | + | 405 | WP_003407786.1 | type II toxin-antitoxin system toxin ribonuclease VapC11 | Toxin |
MBS3601_RS08110 | 1755564..1757306 | - | 1743 | WP_010950559.1 | malto-oligosyltrehalose trehalohydrolase | - |
MBS3601_RS08115 | 1757299..1759596 | - | 2298 | WP_003407790.1 | malto-oligosyltrehalose synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14650.76 Da Isoelectric Point: 5.6587
>T288834 WP_003407786.1 NZ_LR699570:1755143-1755547 [Mycobacterium tuberculosis variant bovis]
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|