Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1687995..1688611 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TJ74 |
Locus tag | MBS3601_RS07840 | Protein ID | WP_003407593.1 |
Coordinates | 1688294..1688611 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TJ73 |
Locus tag | MBS3601_RS07835 | Protein ID | WP_003900349.1 |
Coordinates | 1687995..1688297 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS07825 | 1683881..1685728 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
MBS3601_RS07830 | 1685729..1687981 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
MBS3601_RS07835 | 1687995..1688297 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
MBS3601_RS07840 | 1688294..1688611 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
MBS3601_RS07845 | 1688608..1689612 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
MBS3601_RS07850 | 1689665..1690954 | + | 1290 | WP_003407599.1 | serine hydrolase | - |
MBS3601_RS07855 | 1691027..1691800 | - | 774 | WP_003912632.1 | class I SAM-dependent methyltransferase | - |
MBS3601_RS07860 | 1691858..1692049 | - | 192 | WP_003407609.1 | dodecin family protein | - |
MBS3601_RS07865 | 1692080..1692304 | - | 225 | WP_160522526.1 | NUDIX domain-containing protein | - |
MBS3601_RS07870 | 1692574..1693602 | + | 1029 | WP_011799189.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T288833 WP_003407593.1 NZ_LR699570:1688294-1688611 [Mycobacterium tuberculosis variant bovis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11173.42 Da Isoelectric Point: 9.5564
>AT288833 WP_003900349.1 NZ_LR699570:1687995-1688297 [Mycobacterium tuberculosis variant bovis]
VPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYES
EAERSAARARRNARQQRSAQ
VPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYES
EAERSAARARRNARQQRSAQ
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|