Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 1575375..1576030 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A7U4FAR1 |
Locus tag | MBS3601_RS07325 | Protein ID | WP_003407268.1 |
Coordinates | 1575375..1575776 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TIK2 |
Locus tag | MBS3601_RS07330 | Protein ID | WP_003407272.1 |
Coordinates | 1575773..1576030 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS07310 | 1571219..1572604 | - | 1386 | WP_003407260.1 | cytochrome P450 | - |
MBS3601_RS07315 | 1572682..1573716 | + | 1035 | WP_003407264.1 | AraC family transcriptional regulator | - |
MBS3601_RS07320 | 1573762..1575120 | - | 1359 | WP_010950541.1 | PE family protein | - |
MBS3601_RS07325 | 1575375..1575776 | - | 402 | WP_003407268.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MBS3601_RS07330 | 1575773..1576030 | - | 258 | WP_003407272.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
MBS3601_RS07335 | 1576113..1577072 | - | 960 | WP_003407276.1 | alpha/beta hydrolase | - |
MBS3601_RS07340 | 1577097..1578059 | - | 963 | WP_003407279.1 | alpha/beta hydrolase | - |
MBS3601_RS07345 | 1578058..1578795 | + | 738 | WP_031647000.1 | lysoplasmalogenase | - |
MBS3601_RS07350 | 1578876..1580843 | + | 1968 | WP_003407285.1 | primosomal protein N' | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14894.39 Da Isoelectric Point: 11.6897
>T288832 WP_003407268.1 NZ_LR699570:c1575776-1575375 [Mycobacterium tuberculosis variant bovis]
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQGLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQGLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FAR1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TIK2 |