Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 1389146..1389705 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0THS1 |
Locus tag | MBS3601_RS06515 | Protein ID | WP_003898789.1 |
Coordinates | 1389146..1389439 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G0THS2 |
Locus tag | MBS3601_RS06520 | Protein ID | WP_003406322.1 |
Coordinates | 1389436..1389705 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS06490 | 1384740..1385000 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | - |
MBS3601_RS06495 | 1384997..1385428 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | - |
MBS3601_RS06500 | 1385451..1387138 | - | 1688 | Protein_1282 | PE family protein | - |
MBS3601_RS06505 | 1387318..1388178 | + | 861 | WP_003406306.1 | hypothetical protein | - |
MBS3601_RS06510 | 1388259..1389089 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
MBS3601_RS06515 | 1389146..1389439 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
MBS3601_RS06520 | 1389436..1389705 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MBS3601_RS06525 | 1389818..1393513 | - | 3696 | WP_010950509.1 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit | - |
MBS3601_RS06530 | 1393655..1394443 | - | 789 | WP_010950510.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11031.57 Da Isoelectric Point: 9.6275
>T288830 WP_003898789.1 NZ_LR699570:c1389439-1389146 [Mycobacterium tuberculosis variant bovis]
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|