Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1384740..1385428 | Replicon | chromosome |
| Accession | NZ_LR699570 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0THR7 |
| Locus tag | MBS3601_RS06495 | Protein ID | WP_003406304.1 |
| Coordinates | 1384997..1385428 (+) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0THR6 |
| Locus tag | MBS3601_RS06490 | Protein ID | WP_003406302.1 |
| Coordinates | 1384740..1385000 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MBS3601_RS06470 | 1380317..1381141 | + | 825 | WP_003900298.1 | trehalose ABC transporter permease SugB | - |
| MBS3601_RS06475 | 1381146..1382327 | + | 1182 | WP_003406299.1 | trehalose ABC transporter ATP-binding protein SugC | - |
| MBS3601_RS06480 | 1382404..1383504 | - | 1101 | WP_003406300.1 | magnesium/cobalt transporter CorA | - |
| MBS3601_RS06485 | 1383675..1384664 | + | 990 | WP_003406301.1 | malate dehydrogenase | - |
| MBS3601_RS06490 | 1384740..1385000 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | Antitoxin |
| MBS3601_RS06495 | 1384997..1385428 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MBS3601_RS06500 | 1385451..1387138 | - | 1688 | Protein_1282 | PE family protein | - |
| MBS3601_RS06505 | 1387318..1388178 | + | 861 | WP_003406306.1 | hypothetical protein | - |
| MBS3601_RS06510 | 1388259..1389089 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| MBS3601_RS06515 | 1389146..1389439 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | - |
| MBS3601_RS06520 | 1389436..1389705 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15873.08 Da Isoelectric Point: 5.8838
>T288829 WP_003406304.1 NZ_LR699570:1384997-1385428 [Mycobacterium tuberculosis variant bovis]
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|