Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1231155..1231786 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A7U4F9D0 |
Locus tag | MBS3601_RS05795 | Protein ID | WP_003405820.1 |
Coordinates | 1231155..1231466 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TGZ7 |
Locus tag | MBS3601_RS05800 | Protein ID | WP_003405836.1 |
Coordinates | 1231466..1231786 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS05775 | 1226637..1228061 | - | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
MBS3601_RS05780 | 1228092..1229180 | - | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
MBS3601_RS05785 | 1229236..1229880 | + | 645 | WP_174813088.1 | DUF4245 domain-containing protein | - |
MBS3601_RS05790 | 1229887..1231043 | - | 1157 | Protein_1140 | AI-2E family transporter | - |
MBS3601_RS05795 | 1231155..1231466 | - | 312 | WP_003405820.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
MBS3601_RS05800 | 1231466..1231786 | - | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
MBS3601_RS05805 | 1231796..1233321 | + | 1526 | Protein_1143 | carboxylesterase/lipase family protein | - |
MBS3601_RS05810 | 1233339..1234451 | - | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
MBS3601_RS05815 | 1234461..1234718 | - | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
MBS3601_RS05820 | 1234708..1235955 | - | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
MBS3601_RS05825 | 1235952..1236590 | - | 639 | WP_156068427.1 | lipid droplet-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11061.82 Da Isoelectric Point: 4.9371
>T288827 WP_003405820.1 NZ_LR699570:c1231466-1231155 [Mycobacterium tuberculosis variant bovis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Download Length: 107 a.a. Molecular weight: 11394.83 Da Isoelectric Point: 5.1236
>AT288827 WP_003405836.1 NZ_LR699570:c1231786-1231466 [Mycobacterium tuberculosis variant bovis]
MYLPWGVVLAGGANGFGAGAYQTGTICEVSTQIAVRLPDEIVAFIDDEVRGQHARSRAAVVLRALERERRRRLAERDAEI
LATNTSATGDLDTLAGHCARTALDID
MYLPWGVVLAGGANGFGAGAYQTGTICEVSTQIAVRLPDEIVAFIDDEVRGQHARSRAAVVLRALERERRRRLAERDAEI
LATNTSATGDLDTLAGHCARTALDID
Download Length: 321 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F9D0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TGZ7 |