Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 841937..842646 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A7U4F979 |
Locus tag | MBS3601_RS03940 | Protein ID | WP_003903160.1 |
Coordinates | 842218..842646 (+) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TEX4 |
Locus tag | MBS3601_RS03935 | Protein ID | WP_003403834.1 |
Coordinates | 841937..842194 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS03930 | 839118..841846 | + | 2729 | Protein_777 | PE family protein | - |
MBS3601_RS03935 | 841937..842194 | + | 258 | WP_003403834.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
MBS3601_RS03940 | 842218..842646 | + | 429 | WP_003903160.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MBS3601_RS03945 | 842736..842910 | - | 175 | Protein_780 | transposase | - |
MBS3601_RS03950 | 843023..843268 | + | 246 | WP_003403841.1 | hypothetical protein | - |
MBS3601_RS03955 | 843337..844221 | - | 885 | WP_011799127.1 | 3-hydroxyisobutyrate dehydrogenase | - |
MBS3601_RS03960 | 844232..845404 | - | 1173 | WP_010950438.1 | acyl-CoA dehydrogenase family protein | - |
MBS3601_RS03965 | 845411..846943 | - | 1533 | WP_069523346.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15799.21 Da Isoelectric Point: 7.5536
>T288823 WP_003903160.1 NZ_LR699570:842218-842646 [Mycobacterium tuberculosis variant bovis]
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLVLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLVLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F979 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TEX4 |