Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-mazE/PIN(toxin)
Location 755551..756343 Replicon chromosome
Accession NZ_LR699570
Organism Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608

Toxin (Protein)


Gene name vapC Uniprot ID P9WFB2
Locus tag MBS3601_RS03470 Protein ID WP_003403386.1
Coordinates 755906..756343 (-) Length 146 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID G0TQE0
Locus tag MBS3601_RS03465 Protein ID WP_003403381.1
Coordinates 755551..755796 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MBS3601_RS03435 750571..752076 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
MBS3601_RS03440 752157..753167 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
MBS3601_RS03445 753555..753938 - 384 WP_003403365.1 ribonuclease VapC6 -
MBS3601_RS03450 754033..754188 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin -
MBS3601_RS03455 754264..754980 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
MBS3601_RS03460 755256..755564 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
MBS3601_RS03465 755551..755796 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family Antitoxin
MBS3601_RS03470 755906..756343 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin Toxin
MBS3601_RS03475 756340..756594 - 255 WP_003911263.1 antitoxin VapB7 -
MBS3601_RS03480 756708..759071 + 2364 WP_003403397.1 arylsulfatase AtsD -
MBS3601_RS03485 759134..759460 + 327 WP_003403401.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
MBS3601_RS03490 759372..759710 + 339 WP_003403405.1 PIN domain-containing protein -
MBS3601_RS03495 759707..759880 + 174 WP_003898549.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-126)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 146 a.a.        Molecular weight: 15245.39 Da        Isoelectric Point: 5.1865

>T288821 WP_003403386.1 NZ_LR699570:c756343-755906 [Mycobacterium tuberculosis variant bovis]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR

Download         Length: 438 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9169.01 Da        Isoelectric Point: 4.2070

>AT288821 WP_003403381.1 NZ_LR699570:c755796-755551 [Mycobacterium tuberculosis variant bovis]
MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENALAEIADWGPAEDWADWADAA
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSW5

Antitoxin

Source ID Structure
AlphaFold DB G0TQE0

References