Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 753555..754188 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQD6 |
Locus tag | MBS3601_RS03445 | Protein ID | WP_003403365.1 |
Coordinates | 753555..753938 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ56 |
Locus tag | MBS3601_RS03450 | Protein ID | WP_003403368.1 |
Coordinates | 754033..754188 (-) | Length | 52 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS03420 | 748847..749383 | + | 537 | WP_003403341.1 | 50S ribosomal protein L10 | - |
MBS3601_RS03425 | 749420..749812 | + | 393 | WP_003403353.1 | 50S ribosomal protein L7/L12 | - |
MBS3601_RS03430 | 749805..750500 | - | 696 | WP_003403355.1 | TetR/AcrR family transcriptional regulator | - |
MBS3601_RS03435 | 750571..752076 | + | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
MBS3601_RS03440 | 752157..753167 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
MBS3601_RS03445 | 753555..753938 | - | 384 | WP_003403365.1 | ribonuclease VapC6 | Toxin |
MBS3601_RS03450 | 754033..754188 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MBS3601_RS03455 | 754264..754980 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
MBS3601_RS03460 | 755256..755564 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
MBS3601_RS03465 | 755551..755796 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | - |
MBS3601_RS03470 | 755906..756343 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | - |
MBS3601_RS03475 | 756340..756594 | - | 255 | WP_003911263.1 | antitoxin VapB7 | - |
MBS3601_RS03480 | 756708..759071 | + | 2364 | WP_003403397.1 | arylsulfatase AtsD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13959.73 Da Isoelectric Point: 6.0803
>T288819 WP_003403365.1 NZ_LR699570:c753938-753555 [Mycobacterium tuberculosis variant bovis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQD6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSF8 |