288819

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 753555..754188 Replicon chromosome
Accession NZ_LR699570
Organism Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608

Toxin (Protein)


Gene name vapC Uniprot ID G0TQD6
Locus tag MBS3601_RS03445 Protein ID WP_003403365.1
Coordinates 753555..753938 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ56
Locus tag MBS3601_RS03450 Protein ID WP_003403368.1
Coordinates 754033..754188 (-) Length 52 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MBS3601_RS03420 748847..749383 + 537 WP_003403341.1 50S ribosomal protein L10 -
MBS3601_RS03425 749420..749812 + 393 WP_003403353.1 50S ribosomal protein L7/L12 -
MBS3601_RS03430 749805..750500 - 696 WP_003403355.1 TetR/AcrR family transcriptional regulator -
MBS3601_RS03435 750571..752076 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
MBS3601_RS03440 752157..753167 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
MBS3601_RS03445 753555..753938 - 384 WP_003403365.1 ribonuclease VapC6 Toxin
MBS3601_RS03450 754033..754188 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MBS3601_RS03455 754264..754980 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
MBS3601_RS03460 755256..755564 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
MBS3601_RS03465 755551..755796 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family -
MBS3601_RS03470 755906..756343 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
MBS3601_RS03475 756340..756594 - 255 WP_003911263.1 antitoxin VapB7 -
MBS3601_RS03480 756708..759071 + 2364 WP_003403397.1 arylsulfatase AtsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13959.73 Da        Isoelectric Point: 6.0803

>T288819 WP_003403365.1 NZ_LR699570:c753938-753555 [Mycobacterium tuberculosis variant bovis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD

Download         Length: 384 bp

Antitoxin


Download         Length: 52 a.a.        Molecular weight: 5872.72 Da        Isoelectric Point: 5.7734

>AT288819 WP_003403368.1 NZ_LR699570:c754188-754033 [Mycobacterium tuberculosis variant bovis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE

Download         Length: 156 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQD6

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BSF8

References