Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
| Location | 718073..718737 | Replicon | chromosome |
| Accession | NZ_LR699570 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P96917 |
| Locus tag | MBS3601_RS03275 | Protein ID | WP_003403246.1 |
| Coordinates | 718330..718737 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WF18 |
| Locus tag | MBS3601_RS03270 | Protein ID | WP_003403244.1 |
| Coordinates | 718073..718333 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MBS3601_RS03245 | 714250..715407 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
| MBS3601_RS03250 | 715418..716365 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
| MBS3601_RS03255 | 716458..716712 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | - |
| MBS3601_RS03260 | 716712..717107 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | - |
| MBS3601_RS03265 | 717201..717941 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
| MBS3601_RS03270 | 718073..718333 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MBS3601_RS03275 | 718330..718737 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MBS3601_RS03280 | 718809..719960 | - | 1152 | WP_003403248.1 | FIST C-terminal domain-containing protein | - |
| MBS3601_RS03285 | 720053..721780 | - | 1728 | WP_010950423.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14376.37 Da Isoelectric Point: 4.3568
>T288818 WP_003403246.1 NZ_LR699570:718330-718737 [Mycobacterium tuberculosis variant bovis]
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3DBO |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3DBO | |
| AlphaFold DB | A0A7U4BSE4 |