Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 710829..711454 | Replicon | chromosome |
| Accession | NZ_LR699570 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQA0 |
| Locus tag | MBS3601_RS03225 | Protein ID | WP_003403218.1 |
| Coordinates | 711053..711454 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ36 |
| Locus tag | MBS3601_RS03220 | Protein ID | WP_003403213.1 |
| Coordinates | 710829..711056 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MBS3601_RS03195 | 706009..706230 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
| MBS3601_RS03200 | 706372..706977 | + | 606 | WP_003898526.1 | hypothetical protein | - |
| MBS3601_RS03205 | 706996..709562 | - | 2567 | Protein_635 | SEC-C domain-containing protein | - |
| MBS3601_RS03210 | 709646..710395 | + | 750 | WP_003898528.1 | hypothetical protein | - |
| MBS3601_RS03215 | 710392..710634 | + | 243 | WP_003403210.1 | hypothetical protein | - |
| MBS3601_RS03220 | 710829..711056 | + | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
| MBS3601_RS03225 | 711053..711454 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
| MBS3601_RS03230 | 711583..711666 | + | 84 | Protein_640 | galactose-1-phosphate uridylyltransferase | - |
| MBS3601_RS03235 | 711685..712767 | + | 1083 | WP_031652152.1 | galactose-1-phosphate uridylyltransferase | - |
| MBS3601_RS03240 | 712764..713855 | + | 1092 | WP_003403225.1 | galactokinase | - |
| MBS3601_RS03245 | 714250..715407 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
| MBS3601_RS03250 | 715418..716365 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T288816 WP_003403218.1 NZ_LR699570:711053-711454 [Mycobacterium tuberculosis variant bovis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQA0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSC9 |