Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 703292..703935 Replicon chromosome
Accession NZ_LR699570
Organism Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608

Toxin (Protein)


Gene name vapC Uniprot ID P67239
Locus tag MBS3601_RS03175 Protein ID WP_003403187.1
Coordinates 703534..703935 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ91
Locus tag MBS3601_RS03170 Protein ID WP_003403184.1
Coordinates 703292..703537 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MBS3601_RS03135 698572..699102 - 531 WP_003917320.1 two component system sensor kinase HK2 -
MBS3601_RS03140 699086..699781 - 696 WP_197044064.1 response regulator transcription factor -
MBS3601_RS03145 699904..700215 + 312 WP_003403164.1 hypothetical protein -
MBS3601_RS03150 700287..701237 + 951 WP_003907436.1 DUF1259 domain-containing protein -
MBS3601_RS03155 701478..702062 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
MBS3601_RS03160 702064..702774 + 711 Protein_626 transposase -
MBS3601_RS03165 702777..703247 + 471 WP_003898523.1 hypothetical protein -
MBS3601_RS03170 703292..703537 + 246 WP_003403184.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MBS3601_RS03175 703534..703935 + 402 WP_003403187.1 type II toxin-antitoxin system VapC family toxin Toxin
MBS3601_RS03180 704323..704490 - 168 WP_077385191.1 DUF3800 domain-containing protein -
MBS3601_RS03185 704523..704720 - 198 WP_003403191.1 hypothetical protein -
MBS3601_RS03190 704800..705957 - 1158 WP_003403193.1 hypothetical protein -
MBS3601_RS03195 706009..706230 - 222 WP_003898525.1 DUF4926 domain-containing protein -
MBS3601_RS03200 706372..706977 + 606 WP_003898526.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-124)

Antitoxin

Antitoxin VapB-like

(1-80)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14501.21 Da        Isoelectric Point: 4.4463

>T288815 WP_003403187.1 NZ_LR699570:703534-703935 [Mycobacterium tuberculosis variant bovis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR

Download         Length: 402 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8813.12 Da        Isoelectric Point: 10.3486

>AT288815 WP_003403184.1 NZ_LR699570:703292-703537 [Mycobacterium tuberculosis variant bovis]
MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLP
A

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSD6

Antitoxin

Source ID Structure
AlphaFold DB G0TQ91

References