Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 703292..703935 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67239 |
Locus tag | MBS3601_RS03175 | Protein ID | WP_003403187.1 |
Coordinates | 703534..703935 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ91 |
Locus tag | MBS3601_RS03170 | Protein ID | WP_003403184.1 |
Coordinates | 703292..703537 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS03135 | 698572..699102 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
MBS3601_RS03140 | 699086..699781 | - | 696 | WP_197044064.1 | response regulator transcription factor | - |
MBS3601_RS03145 | 699904..700215 | + | 312 | WP_003403164.1 | hypothetical protein | - |
MBS3601_RS03150 | 700287..701237 | + | 951 | WP_003907436.1 | DUF1259 domain-containing protein | - |
MBS3601_RS03155 | 701478..702062 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
MBS3601_RS03160 | 702064..702774 | + | 711 | Protein_626 | transposase | - |
MBS3601_RS03165 | 702777..703247 | + | 471 | WP_003898523.1 | hypothetical protein | - |
MBS3601_RS03170 | 703292..703537 | + | 246 | WP_003403184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MBS3601_RS03175 | 703534..703935 | + | 402 | WP_003403187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MBS3601_RS03180 | 704323..704490 | - | 168 | WP_077385191.1 | DUF3800 domain-containing protein | - |
MBS3601_RS03185 | 704523..704720 | - | 198 | WP_003403191.1 | hypothetical protein | - |
MBS3601_RS03190 | 704800..705957 | - | 1158 | WP_003403193.1 | hypothetical protein | - |
MBS3601_RS03195 | 706009..706230 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
MBS3601_RS03200 | 706372..706977 | + | 606 | WP_003898526.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14501.21 Da Isoelectric Point: 4.4463
>T288815 WP_003403187.1 NZ_LR699570:703534-703935 [Mycobacterium tuberculosis variant bovis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSD6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ91 |