Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 694887..695533 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O07783 |
Locus tag | MBS3601_RS03105 | Protein ID | WP_003403122.1 |
Coordinates | 694887..695279 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ86 |
Locus tag | MBS3601_RS03110 | Protein ID | WP_003403125.1 |
Coordinates | 695276..695533 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS03090 | 690548..691984 | + | 1437 | WP_003900182.1 | virulence factor Mce family protein | - |
MBS3601_RS03095 | 692138..693280 | + | 1143 | WP_003911253.1 | virulence factor Mce family protein | - |
MBS3601_RS03100 | 693285..694835 | + | 1551 | WP_003403119.1 | MCE family protein | - |
MBS3601_RS03105 | 694887..695279 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | Toxin |
MBS3601_RS03110 | 695276..695533 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | Antitoxin |
MBS3601_RS03115 | 695716..696951 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
MBS3601_RS03120 | 697202..697615 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | - |
MBS3601_RS03125 | 697612..697848 | - | 237 | WP_003403139.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
MBS3601_RS03130 | 697952..698458 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
MBS3601_RS03135 | 698572..699102 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
MBS3601_RS03140 | 699086..699781 | - | 696 | WP_197044064.1 | response regulator transcription factor | - |
MBS3601_RS03145 | 699904..700215 | + | 312 | WP_003403164.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14080.08 Da Isoelectric Point: 4.6558
>T288813 WP_003403122.1 NZ_LR699570:c695279-694887 [Mycobacterium tuberculosis variant bovis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F8V4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ86 |