Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 363903..364546 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFB8 |
Locus tag | MBS3601_RS01600 | Protein ID | WP_003401566.1 |
Coordinates | 364121..364546 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O07227 |
Locus tag | MBS3601_RS01595 | Protein ID | WP_003401563.1 |
Coordinates | 363903..364124 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS01570 | 359022..359825 | - | 804 | WP_003401540.1 | hypothetical protein | - |
MBS3601_RS01575 | 359835..361232 | - | 1398 | WP_003401544.1 | sulfatase | - |
MBS3601_RS01580 | 361411..363186 | + | 1776 | WP_010886074.1 | PE family protein | - |
MBS3601_RS01585 | 363329..363556 | + | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | - |
MBS3601_RS01590 | 363553..363855 | + | 303 | WP_003401560.1 | toxin-antitoxin system toxin | - |
MBS3601_RS01595 | 363903..364124 | + | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
MBS3601_RS01600 | 364121..364546 | + | 426 | WP_003401566.1 | PIN domain nuclease | Toxin |
MBS3601_RS01605 | 364681..365313 | + | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
MBS3601_RS01610 | 365310..366218 | + | 909 | WP_003900117.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15713.90 Da Isoelectric Point: 5.6002
>T288810 WP_003401566.1 NZ_LR699570:364121-364546 [Mycobacterium tuberculosis variant bovis]
VTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRAL
EVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
VTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRAL
EVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|