Detailed information of TA system TA288802

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relE-pasA/RelE-HTH
• Location: 1383462..1383930
• Replicon: chromosome
• Accession: NZ_LR699119
• Organism: Aquicella siphonis strain SGT-108

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: AQULUS_RS06560
• Protein ID: WP_197737334.1
• Coordinates: 1383462..1383689 (-)
• Length: 76 a.a.

Antitoxin (Protein)

• Gene name: pasA
• Uniprot ID: -
• Locus tag: AQULUS_RS06565
• Protein ID: WP_148339287.1
• Coordinates: 1383715..1383930 (-)
• Length: 72 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AQULUS_RS06520	1378911..1379291	-	381	WP_148339278.1	sigma-70 family RNA polymerase sigma factor	-
AQULUS_RS06525	1379328..1379702	-	375	WP_197737298.1	hypothetical protein	-
AQULUS_RS06530	1379759..1380097	-	339	WP_148339279.1	DUF1064 domain-containing protein	-
AQULUS_RS06535	1380039..1380479	-	441	WP_148339280.1	hypothetical protein	-
AQULUS_RS06540	1380848..1381804	-	957	WP_148339282.1	hypothetical protein	-
AQULUS_RS06545	1381984..1382181	-	198	WP_148339283.1	helix-turn-helix domain-containing protein	-
AQULUS_RS06550	1382313..1383005	+	693	WP_172622762.1	helix-turn-helix domain-containing protein	-
AQULUS_RS06555	1383039..1383368	+	330	WP_148339285.1	helix-turn-helix domain-containing protein	-
AQULUS_RS06560	1383462..1383689	-	228	WP_197737334.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
AQULUS_RS06565	1383715..1383930	-	216	WP_148339287.1	ribbon-helix-helix protein, CopG family	Antitoxin
AQULUS_RS06570	1384137..1384868	-	732	WP_148339288.1	hypothetical protein	-
AQULUS_RS06575	1385085..1385567	-	483	WP_148339289.1	hypothetical protein	-
AQULUS_RS06580	1386023..1387057	+	1035	WP_148339290.1	site-specific integrase	-
AQULUS_RS06590	1387227..1387817	-	591	WP_172622763.1	DUF924 domain-containing protein	-
AQULUS_RS06595	1387934..1388419	-	486	WP_148339292.1	L,D-transpeptidase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (3-73)

Antitoxin

• Ribbon-helix-helix protein, CopG (4-39)

Sequences

Toxin

Protein

• Length: 76 a.a.
• Molecular weight: 8687.19 Da
• Isoelectric Point: 10.1396

>T288802 WP_197737334.1 NZ_LR699119:c1383689-1383462 [Aquicella siphonis]
MKKMDKATANIIDKYLTLRVATLDDPTQLGKALLHNKSGLWRYRIADHRVICQLNNNELIVLVLKVGHRKNVYDE

Nucleotide

• Length: 228 bp

Antitoxin

Protein

• Length: 72 a.a.
• Molecular weight: 8183.27 Da
• Isoelectric Point: 4.5994

>AT288802 WP_148339287.1 NZ_LR699119:c1383930-1383715 [Aquicella siphonis]
MAIAIRLSPELDKRLDALAKKTHRSKSYYAREAIENYIEDLEDYYLGVAILENPGNIYTSEEVRKMCGLDD

Nucleotide

• Length: 216 bp