Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 53208..53842 | Replicon | plasmid 3 |
| Accession | NZ_LR699116 | ||
| Organism | Aquicella lusitana strain SGT-39 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | AQUSIP_RS11635 | Protein ID | WP_114835515.1 |
| Coordinates | 53208..53612 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | AQUSIP_RS11640 | Protein ID | WP_114835516.1 |
| Coordinates | 53612..53842 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AQUSIP_RS11610 | 48471..49517 | - | 1047 | WP_114835537.1 | IS481 family transposase | - |
| AQUSIP_RS11615 | 49750..50201 | - | 452 | Protein_52 | recombinase family protein | - |
| AQUSIP_RS11620 | 50209..51186 | - | 978 | WP_114835533.1 | hypothetical protein | - |
| AQUSIP_RS11625 | 51352..52398 | + | 1047 | WP_114835537.1 | IS481 family transposase | - |
| AQUSIP_RS11630 | 52450..52791 | - | 342 | WP_114835514.1 | hypothetical protein | - |
| AQUSIP_RS11635 | 53208..53612 | - | 405 | WP_114835515.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| AQUSIP_RS11640 | 53612..53842 | - | 231 | WP_114835516.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| AQUSIP_RS11645 | 54189..55019 | - | 831 | WP_114835517.1 | hypothetical protein | - |
| AQUSIP_RS11650 | 55417..56769 | + | 1353 | WP_170131897.1 | hypothetical protein | - |
| AQUSIP_RS11655 | 56851..57897 | + | 1047 | WP_114835537.1 | IS481 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..92205 | 92205 | |
| - | inside | IScluster/Tn | - | - | 43228..57897 | 14669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15293.70 Da Isoelectric Point: 7.2759
>T288801 WP_114835515.1 NZ_LR699116:c53612-53208 [Aquicella lusitana]
MRLRYLLDTNICIYIAKQKPATVMKKFEELEVGQVAMSVITYGELLYGANKSQSPDAAHSKLVELTTLIPALELNNEVAE
HYGDIRRNLEKFGKPIGNNDLWIASHARALDVILVTNNLREFDRVPKLRIENWV
MRLRYLLDTNICIYIAKQKPATVMKKFEELEVGQVAMSVITYGELLYGANKSQSPDAAHSKLVELTTLIPALELNNEVAE
HYGDIRRNLEKFGKPIGNNDLWIASHARALDVILVTNNLREFDRVPKLRIENWV
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|