Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 132124..132722 | Replicon | chromosome |
Accession | NZ_LR699115 | ||
Organism | Aquicella lusitana strain SGT-39 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | AQUSIP_RS10670 | Protein ID | WP_114834773.1 |
Coordinates | 132402..132722 (+) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | AQUSIP_RS10665 | Protein ID | WP_114834774.1 |
Coordinates | 132124..132387 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AQUSIP_RS10645 | 127552..128136 | + | 585 | WP_114834779.1 | YceI family protein | - |
AQUSIP_RS10650 | 128269..129054 | + | 786 | WP_170131838.1 | alpha/beta hydrolase | - |
AQUSIP_RS10655 | 129479..131023 | - | 1545 | WP_114834776.1 | hypothetical protein | - |
AQUSIP_RS10660 | 131071..131895 | - | 825 | WP_147277496.1 | hypothetical protein | - |
AQUSIP_RS10665 | 132124..132387 | + | 264 | WP_114834774.1 | hypothetical protein | Antitoxin |
AQUSIP_RS10670 | 132402..132722 | + | 321 | WP_114834773.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
AQUSIP_RS10675 | 132732..133820 | - | 1089 | WP_114834772.1 | PA0069 family radical SAM protein | - |
AQUSIP_RS10680 | 133832..135076 | - | 1245 | WP_114834771.1 | Y-family DNA polymerase | - |
AQUSIP_RS10685 | 135080..135592 | - | 513 | WP_114834770.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
AQUSIP_RS10690 | 135888..137078 | + | 1191 | WP_114834769.1 | multidrug effflux MFS transporter | - |
AQUSIP_RS10695 | 137094..137708 | - | 615 | WP_147277495.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11612.51 Da Isoelectric Point: 9.3884
>T288800 WP_114834773.1 NZ_LR699115:132402-132722 [Aquicella lusitana]
MNRGEVYWIDLNPTKGSEINKQRPCVIVSATPINRARSTVVVVPLSTAARPRPPIVVEVTCLGKQVVAICDQIRTVDKSR
LLKSAGNLSAQEMDSLDESLRQVLSL
MNRGEVYWIDLNPTKGSEINKQRPCVIVSATPINRARSTVVVVPLSTAARPRPPIVVEVTCLGKQVVAICDQIRTVDKSR
LLKSAGNLSAQEMDSLDESLRQVLSL
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|