Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 904277..904911 | Replicon | chromosome |
| Accession | NZ_LR699114 | ||
| Organism | Aquicella lusitana strain SGT-39 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | AQUSIP_RS04210 | Protein ID | WP_114835515.1 |
| Coordinates | 904507..904911 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | AQUSIP_RS04205 | Protein ID | WP_114835516.1 |
| Coordinates | 904277..904507 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AQUSIP_RS04190 | 900222..901268 | - | 1047 | WP_114835537.1 | IS481 family transposase | - |
| AQUSIP_RS04195 | 901350..902702 | - | 1353 | WP_170131897.1 | hypothetical protein | - |
| AQUSIP_RS04200 | 903100..903930 | + | 831 | WP_114835517.1 | hypothetical protein | - |
| AQUSIP_RS04205 | 904277..904507 | + | 231 | WP_114835516.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| AQUSIP_RS04210 | 904507..904911 | + | 405 | WP_114835515.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| AQUSIP_RS04215 | 905328..905669 | + | 342 | WP_114835514.1 | hypothetical protein | - |
| AQUSIP_RS04220 | 905721..906767 | - | 1047 | WP_114835537.1 | IS481 family transposase | - |
| AQUSIP_RS04225 | 906933..907910 | + | 978 | WP_114835533.1 | hypothetical protein | - |
| AQUSIP_RS04230 | 907918..908369 | + | 452 | Protein_825 | recombinase family protein | - |
| AQUSIP_RS04235 | 908602..909648 | + | 1047 | WP_114835537.1 | IS481 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 900222..917978 | 17756 | |
| - | inside | IScluster/Tn | - | - | 900222..909648 | 9426 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15293.70 Da Isoelectric Point: 7.2759
>T288798 WP_114835515.1 NZ_LR699114:904507-904911 [Aquicella lusitana]
MRLRYLLDTNICIYIAKQKPATVMKKFEELEVGQVAMSVITYGELLYGANKSQSPDAAHSKLVELTTLIPALELNNEVAE
HYGDIRRNLEKFGKPIGNNDLWIASHARALDVILVTNNLREFDRVPKLRIENWV
MRLRYLLDTNICIYIAKQKPATVMKKFEELEVGQVAMSVITYGELLYGANKSQSPDAAHSKLVELTTLIPALELNNEVAE
HYGDIRRNLEKFGKPIGNNDLWIASHARALDVILVTNNLREFDRVPKLRIENWV
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|