Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 749309..749874 Replicon chromosome
Accession NZ_LR699017
Organism Faecalibacterium prausnitzii isolate MGYG-HGUT-02545

Toxin (Protein)


Gene name relE Uniprot ID C7H6P5
Locus tag FX139_RS03650 Protein ID WP_002596328.1
Coordinates 749584..749874 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C7H6P4
Locus tag FX139_RS03645 Protein ID WP_005924829.1
Coordinates 749309..749587 (+) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FX139_RS03605 744504..745016 - 513 WP_003533443.1 RNA polymerase sigma factor -
FX139_RS03610 745274..745402 - 129 Protein_698 hypothetical protein -
FX139_RS03615 745466..746278 - 813 WP_113998922.1 type IV secretory system conjugative DNA transfer family protein -
FX139_RS03620 746394..746759 - 366 WP_102288181.1 hypothetical protein -
FX139_RS03625 746838..747032 - 195 WP_014081137.1 transposon-encoded TnpW family protein -
FX139_RS03630 747076..747939 - 864 WP_158394901.1 ATP-binding protein -
FX139_RS03635 747936..748670 - 735 WP_118207843.1 phage replisome organizer N-terminal domain-containing protein -
FX139_RS03640 748784..749182 - 399 WP_158394902.1 cysteine-rich VLP domain-containing protein -
FX139_RS03645 749309..749587 + 279 WP_005924829.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
FX139_RS03650 749584..749874 + 291 WP_002596328.1 type II toxin-antitoxin system YafQ family toxin Toxin
FX139_RS03655 749982..751427 - 1446 WP_158394903.1 MobA/MobL family protein -
FX139_RS03660 751615..751905 - 291 WP_158394904.1 DUF3847 domain-containing protein -
FX139_RS03665 751934..752395 - 462 WP_158394905.1 sigma-70 family RNA polymerase sigma factor -
FX139_RS03670 752406..752858 - 453 WP_158394906.1 RNA polymerase subunit sigma-24 -
FX139_RS03675 752962..753375 - 414 WP_158394907.1 sigma-70 family RNA polymerase sigma factor -
FX139_RS03680 753901..754074 - 174 WP_081026450.1 cysteine-rich KTR domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 688739..754846 66107


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-94)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-90)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11112.87 Da        Isoelectric Point: 8.0630

>T288796 WP_002596328.1 NZ_LR699017:749584-749874 [Faecalibacterium prausnitzii]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK

Download         Length: 291 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10247.66 Da        Isoelectric Point: 4.4692

>AT288796 WP_005924829.1 NZ_LR699017:749309-749587 [Faecalibacterium prausnitzii]
MAGNTTNISIRMDADLKAQADALFTELGMNLTTAFNIFVRQSLREGGIPFEVRLEQPNKETVAAMLEAERIAKDPSVKGY
NDLDELFADLKR

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M4XBM1

Antitoxin

Source ID Structure
AlphaFold DB A0A1M4XB19

References