Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4308619..4309217 | Replicon | chromosome |
| Accession | NZ_LR699014 | ||
| Organism | Citrobacter werkmanii isolate MGYG-HGUT-02535 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | FYC27_RS20845 | Protein ID | WP_096758860.1 |
| Coordinates | 4308619..4308993 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | FYC27_RS20850 | Protein ID | WP_170975228.1 |
| Coordinates | 4308993..4309217 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYC27_RS20830 | 4306123..4307025 | + | 903 | WP_096758857.1 | formate dehydrogenase O subunit beta | - |
| FYC27_RS20835 | 4307022..4307657 | + | 636 | WP_096758858.1 | formate dehydrogenase cytochrome b556 subunit | - |
| FYC27_RS20840 | 4307654..4308583 | + | 930 | WP_096758859.1 | formate dehydrogenase accessory protein FdhE | - |
| FYC27_RS20845 | 4308619..4308993 | - | 375 | WP_096758860.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| FYC27_RS20850 | 4308993..4309217 | - | 225 | WP_170975228.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| FYC27_RS20855 | 4309440..4310354 | + | 915 | WP_096758862.1 | alpha/beta hydrolase | - |
| FYC27_RS20860 | 4310394..4311335 | - | 942 | WP_153064726.1 | fatty acid biosynthesis protein FabY | - |
| FYC27_RS20865 | 4311380..4311817 | - | 438 | WP_096758864.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| FYC27_RS20870 | 4311820..4312686 | - | 867 | WP_096758865.1 | virulence factor BrkB family protein | - |
| FYC27_RS20875 | 4312680..4313279 | - | 600 | WP_096758866.1 | glucose-1-phosphatase | - |
| FYC27_RS20880 | 4313385..4314188 | - | 804 | WP_096758867.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13853.08 Da Isoelectric Point: 9.8625
>T288794 WP_096758860.1 NZ_LR699014:c4308993-4308619 [Citrobacter werkmanii]
MVNGSALFDTNILIDLFSGRAEAKYAIETWPPQNAISLITWMEVMVGAKKYRQESRTRVALSAFNIIGVSQDIAERSVRL
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGIPGVITPYQV
MVNGSALFDTNILIDLFSGRAEAKYAIETWPPQNAISLITWMEVMVGAKKYRQESRTRVALSAFNIIGVSQDIAERSVRL
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGIPGVITPYQV
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|