Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 4155031..4155697 | Replicon | chromosome |
Accession | NZ_LR699014 | ||
Organism | Citrobacter werkmanii isolate MGYG-HGUT-02535 |
Toxin (Protein)
Gene name | tad | Uniprot ID | A0A6N6K5Y9 |
Locus tag | FYC27_RS20170 | Protein ID | WP_005132818.1 |
Coordinates | 4155338..4155697 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | FYC27_RS20165 | Protein ID | WP_096758754.1 |
Coordinates | 4155031..4155348 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYC27_RS20130 | 4150640..4151398 | + | 759 | WP_096758746.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
FYC27_RS20135 | 4151472..4151744 | + | 273 | WP_096758747.1 | DUF3811 domain-containing protein | - |
FYC27_RS20140 | 4151741..4152616 | - | 876 | WP_096758748.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
FYC27_RS20145 | 4152867..4153184 | - | 318 | WP_096758749.1 | CcdB family protein | - |
FYC27_RS20150 | 4153184..4153477 | - | 294 | WP_096758750.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
FYC27_RS20155 | 4153574..4153939 | - | 366 | WP_096758751.1 | hypothetical protein | - |
FYC27_RS23795 | 4154071..4154244 | + | 174 | WP_096758752.1 | hypothetical protein | - |
FYC27_RS20160 | 4154743..4155021 | + | 279 | WP_096758753.1 | putative addiction module antidote protein | - |
FYC27_RS20165 | 4155031..4155348 | - | 318 | WP_096758754.1 | helix-turn-helix domain-containing protein | Antitoxin |
FYC27_RS20170 | 4155338..4155697 | - | 360 | WP_005132818.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FYC27_RS20175 | 4155911..4156600 | + | 690 | WP_096758755.1 | dipeptidase PepE | - |
FYC27_RS20180 | 4156729..4158360 | - | 1632 | WP_096758756.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13476.49 Da Isoelectric Point: 10.3799
>T288793 WP_005132818.1 NZ_LR699014:c4155697-4155338 [Citrobacter werkmanii]
MTKPLYWVGHARKDLQGMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNTWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEINLIYQRLKAAQRHAQESGYVT
MTKPLYWVGHARKDLQGMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNTWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEINLIYQRLKAAQRHAQESGYVT
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|