Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3872330..3872846 | Replicon | chromosome |
| Accession | NZ_LR699014 | ||
| Organism | Citrobacter werkmanii isolate MGYG-HGUT-02535 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | FYC27_RS18815 | Protein ID | WP_096758513.1 |
| Coordinates | 3872330..3872614 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | FYC27_RS18820 | Protein ID | WP_096758514.1 |
| Coordinates | 3872604..3872846 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYC27_RS18800 | 3867543..3869195 | + | 1653 | WP_096758511.1 | alpha,alpha-phosphotrehalase | - |
| FYC27_RS18805 | 3869602..3871740 | + | 2139 | WP_096758512.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| FYC27_RS18810 | 3871862..3872326 | + | 465 | WP_096759476.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| FYC27_RS18815 | 3872330..3872614 | - | 285 | WP_096758513.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FYC27_RS18820 | 3872604..3872846 | - | 243 | WP_096758514.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| FYC27_RS18825 | 3872924..3874837 | - | 1914 | WP_096758515.1 | BglG family transcription antiterminator | - |
| FYC27_RS18830 | 3874859..3875599 | - | 741 | WP_096758516.1 | KDGP aldolase family protein | - |
| FYC27_RS18835 | 3875596..3876714 | - | 1119 | WP_096758517.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| FYC27_RS18840 | 3876698..3877831 | - | 1134 | WP_096758518.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10815.65 Da Isoelectric Point: 9.6730
>T288790 WP_096758513.1 NZ_LR699014:c3872614-3872330 [Citrobacter werkmanii]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSACLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSACLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|