Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 3803372..3804051 | Replicon | chromosome |
Accession | NZ_LR699014 | ||
Organism | Citrobacter werkmanii isolate MGYG-HGUT-02535 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | FYC27_RS18485 | Protein ID | WP_096758456.1 |
Coordinates | 3803372..3803713 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | FYC27_RS18490 | Protein ID | WP_096758457.1 |
Coordinates | 3803734..3804051 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYC27_RS18455 | 3798764..3799090 | - | 327 | WP_003830102.1 | DUF1493 family protein | - |
FYC27_RS18460 | 3799084..3799532 | - | 449 | Protein_3569 | hypothetical protein | - |
FYC27_RS18470 | 3800309..3801319 | - | 1011 | WP_096758455.1 | Ldh family oxidoreductase | - |
FYC27_RS18475 | 3801369..3801929 | + | 561 | Protein_3571 | HNH endonuclease | - |
FYC27_RS18480 | 3802111..3803118 | - | 1008 | WP_057059518.1 | restriction endonuclease | - |
FYC27_RS18485 | 3803372..3803713 | - | 342 | WP_096758456.1 | TA system toxin CbtA family protein | Toxin |
FYC27_RS18490 | 3803734..3804051 | - | 318 | WP_096758457.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
FYC27_RS18495 | 3804070..3804291 | - | 222 | WP_096758458.1 | DUF987 family protein | - |
FYC27_RS18500 | 3804301..3804777 | - | 477 | WP_096758459.1 | RadC family protein | - |
FYC27_RS18505 | 3804790..3805248 | - | 459 | WP_096758460.1 | antirestriction protein | - |
FYC27_RS18510 | 3805344..3805583 | - | 240 | WP_096758461.1 | DUF905 domain-containing protein | - |
FYC27_RS18515 | 3805661..3806071 | - | 411 | WP_096758462.1 | hypothetical protein | - |
FYC27_RS18520 | 3806161..3806775 | - | 615 | WP_096758463.1 | hypothetical protein | - |
FYC27_RS18525 | 3806772..3807476 | - | 705 | WP_096758464.1 | WYL domain-containing protein | - |
FYC27_RS18530 | 3807678..3808511 | - | 834 | WP_096758465.1 | DUF945 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3798764..3828429 | 29665 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12877.87 Da Isoelectric Point: 8.9922
>T288789 WP_096758456.1 NZ_LR699014:c3803713-3803372 [Citrobacter werkmanii]
MKTLPATTPQAAKLCLSPVSVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLADAVNFLVDKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRINATL
MKTLPATTPQAAKLCLSPVSVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLADAVNFLVDKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRINATL
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|