Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3265506..3266126 | Replicon | chromosome |
Accession | NZ_LR699014 | ||
Organism | Citrobacter werkmanii isolate MGYG-HGUT-02535 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | FYC27_RS16045 | Protein ID | WP_002892050.1 |
Coordinates | 3265908..3266126 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | FYC27_RS16040 | Protein ID | WP_096758040.1 |
Coordinates | 3265506..3265880 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYC27_RS16030 | 3260652..3261845 | + | 1194 | WP_096758038.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
FYC27_RS16035 | 3261868..3265017 | + | 3150 | WP_096758039.1 | efflux RND transporter permease AcrB | - |
FYC27_RS16040 | 3265506..3265880 | + | 375 | WP_096758040.1 | Hha toxicity modulator TomB | Antitoxin |
FYC27_RS16045 | 3265908..3266126 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
FYC27_RS16050 | 3266399..3266872 | + | 474 | WP_096758041.1 | YlaC family protein | - |
FYC27_RS16055 | 3266946..3267086 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
FYC27_RS16060 | 3267088..3267348 | - | 261 | WP_096758042.1 | type B 50S ribosomal protein L31 | - |
FYC27_RS16065 | 3267533..3269086 | + | 1554 | WP_096758043.1 | EAL domain-containing protein | - |
FYC27_RS16070 | 3269140..3269493 | - | 354 | WP_096758044.1 | DUF1428 family protein | - |
FYC27_RS16075 | 3269576..3270187 | - | 612 | WP_096758045.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T288788 WP_002892050.1 NZ_LR699014:3265908-3266126 [Citrobacter werkmanii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT288788 WP_096758040.1 NZ_LR699014:3265506-3265880 [Citrobacter werkmanii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSNYGINTQDLQKWRKSGSRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSNYGINTQDLQKWRKSGSRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|