Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3151595..3152334 | Replicon | chromosome |
| Accession | NZ_LR699014 | ||
| Organism | Citrobacter werkmanii isolate MGYG-HGUT-02535 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | FYC27_RS15550 | Protein ID | WP_096757948.1 |
| Coordinates | 3151595..3152080 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | FYC27_RS15555 | Protein ID | WP_096757949.1 |
| Coordinates | 3152068..3152334 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYC27_RS15525 | 3147110..3147763 | + | 654 | WP_096757942.1 | enterobactin synthase subunit EntD | - |
| FYC27_RS15530 | 3147753..3148832 | - | 1080 | WP_096757943.1 | alpha/beta hydrolase | - |
| FYC27_RS15535 | 3148916..3149620 | - | 705 | WP_096757944.1 | GNAT family N-acetyltransferase | - |
| FYC27_RS15540 | 3149888..3151006 | + | 1119 | WP_096757946.1 | glutamate--cysteine ligase | - |
| FYC27_RS15545 | 3151073..3151321 | + | 249 | WP_096757947.1 | DUF1158 family protein | - |
| FYC27_RS15550 | 3151595..3152080 | - | 486 | WP_096757948.1 | GNAT family N-acetyltransferase | Toxin |
| FYC27_RS15555 | 3152068..3152334 | - | 267 | WP_096757949.1 | DUF1778 domain-containing protein | Antitoxin |
| FYC27_RS15560 | 3152490..3152831 | - | 342 | WP_096757950.1 | RamA family antibiotic efflux transcriptional regulator | - |
| FYC27_RS15565 | 3152848..3153960 | - | 1113 | WP_096757951.1 | MBL fold metallo-hydrolase | - |
| FYC27_RS15570 | 3154150..3154731 | + | 582 | WP_096757952.1 | TetR/AcrR family transcriptional regulator | - |
| FYC27_RS15575 | 3154731..3155099 | + | 369 | WP_096757953.1 | MmcQ/YjbR family DNA-binding protein | - |
| FYC27_RS15580 | 3155219..3155872 | + | 654 | WP_096757954.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| FYC27_RS15585 | 3155937..3157181 | + | 1245 | WP_096757955.1 | mechanosensitive ion channel family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17732.53 Da Isoelectric Point: 10.0703
>T288787 WP_096757948.1 NZ_LR699014:c3152080-3151595 [Citrobacter werkmanii]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQIAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVELSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQIAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVELSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|