Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 353949..354752 | Replicon | chromosome |
| Accession | NZ_LR699014 | ||
| Organism | Citrobacter werkmanii isolate MGYG-HGUT-02535 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A6N6JYU3 |
| Locus tag | FYC27_RS01705 | Protein ID | WP_024156451.1 |
| Coordinates | 353949..354329 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A5A9BSL8 |
| Locus tag | FYC27_RS01710 | Protein ID | WP_038807908.1 |
| Coordinates | 354387..354752 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYC27_RS01670 | 349378..350286 | - | 909 | WP_096755714.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| FYC27_RS01675 | 350276..350815 | - | 540 | WP_096755715.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | - |
| FYC27_RS01685 | 351414..351793 | - | 380 | Protein_323 | DUF4102 domain-containing protein | - |
| FYC27_RS01690 | 352305..353152 | - | 848 | Protein_324 | DUF4942 domain-containing protein | - |
| FYC27_RS01700 | 353461..353952 | - | 492 | WP_024156452.1 | hypothetical protein | - |
| FYC27_RS01705 | 353949..354329 | - | 381 | WP_024156451.1 | TA system toxin CbtA family protein | Toxin |
| FYC27_RS01710 | 354387..354752 | - | 366 | WP_038807908.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| FYC27_RS01715 | 354774..354995 | - | 222 | WP_024156449.1 | DUF987 domain-containing protein | - |
| FYC27_RS01720 | 355009..355488 | - | 480 | WP_024156448.1 | DNA repair protein RadC | - |
| FYC27_RS01725 | 355501..355974 | - | 474 | WP_024156447.1 | antirestriction protein | - |
| FYC27_RS01735 | 356243..357061 | - | 819 | WP_048242033.1 | DUF945 domain-containing protein | - |
| FYC27_RS01740 | 357177..357437 | - | 261 | WP_048242035.1 | DUF905 family protein | - |
| FYC27_RS01745 | 357628..358095 | - | 468 | WP_048242036.1 | hypothetical protein | - |
| FYC27_RS01750 | 358192..358593 | - | 402 | WP_048242038.1 | hypothetical protein | - |
| FYC27_RS01755 | 358799..359686 | - | 888 | WP_048242072.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14263.44 Da Isoelectric Point: 10.0919
>T288778 WP_024156451.1 NZ_LR699014:c354329-353949 [Citrobacter werkmanii]
MQTLSAIPKRKAPSRPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEEIITQYIDAGISLSDALNFLVEKSELVRIDRPGF
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS
MQTLSAIPKRKAPSRPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEEIITQYIDAGISLSDALNFLVEKSELVRIDRPGF
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS
Download Length: 381 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13344.20 Da Isoelectric Point: 5.8705
>AT288778 WP_038807908.1 NZ_LR699014:c354752-354387 [Citrobacter werkmanii]
MSNPIPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIAGVFSDADLRHLDQAFPVLLKQLELMLVSGELN
PCHQHCVTLYAKGLTCEADSLGSHGYIYTAIYPTPDDSITR
MSNPIPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIAGVFSDADLRHLDQAFPVLLKQLELMLVSGELN
PCHQHCVTLYAKGLTCEADSLGSHGYIYTAIYPTPDDSITR
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6N6JYU3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5A9BSL8 |