Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 3318120..3318685 | Replicon | chromosome |
| Accession | NZ_LR699011 | ||
| Organism | Roseburia hominis isolate MGYG-HGUT-02517 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G2T4T1 |
| Locus tag | FYB86_RS15420 | Protein ID | WP_014081142.1 |
| Coordinates | 3318395..3318685 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G2T4T0 |
| Locus tag | FYB86_RS15415 | Protein ID | WP_014081141.1 |
| Coordinates | 3318120..3318398 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYB86_RS15375 | 3313673..3313882 | - | 210 | WP_015514784.1 | helix-turn-helix transcriptional regulator | - |
| FYB86_RS15380 | 3314019..3314177 | - | 159 | WP_014081135.1 | membrane protein | - |
| FYB86_RS15385 | 3314285..3315097 | - | 813 | WP_080633471.1 | TraM recognition domain-containing protein | - |
| FYB86_RS15390 | 3315206..3315571 | - | 366 | WP_014081136.1 | hypothetical protein | - |
| FYB86_RS15395 | 3315649..3315843 | - | 195 | WP_014081137.1 | transposon-encoded TnpW family protein | - |
| FYB86_RS15400 | 3315887..3316750 | - | 864 | WP_014081138.1 | ATP-binding protein | - |
| FYB86_RS15405 | 3316747..3317481 | - | 735 | WP_014081139.1 | phage replisome organizer N-terminal domain-containing protein | - |
| FYB86_RS15410 | 3317595..3317993 | - | 399 | WP_014081140.1 | cysteine-rich VLP domain-containing protein | - |
| FYB86_RS15415 | 3318120..3318398 | + | 279 | WP_014081141.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| FYB86_RS15420 | 3318395..3318685 | + | 291 | WP_014081142.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| FYB86_RS15425 | 3318763..3320208 | - | 1446 | WP_014081143.1 | MobA/MobL family protein | - |
| FYB86_RS15430 | 3320423..3320713 | - | 291 | WP_014081144.1 | DUF3847 domain-containing protein | - |
| FYB86_RS15435 | 3320742..3321203 | - | 462 | WP_009296689.1 | sigma-70 family RNA polymerase sigma factor | - |
| FYB86_RS15440 | 3321214..3321666 | - | 453 | WP_014081145.1 | hypothetical protein | - |
| FYB86_RS15445 | 3321770..3322183 | - | 414 | WP_014081146.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3322559..3323749 | 1190 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11153.97 Da Isoelectric Point: 9.4307
>T288776 WP_014081142.1 NZ_LR699011:3318395-3318685 [Roseburia hominis]
MRKTKYTVKYTTAFKKDYKRAIKRGLKIELLEQVVALLSMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEEDVL
VLTLARTGTHSDLFGK
MRKTKYTVKYTTAFKKDYKRAIKRGLKIELLEQVVALLSMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEEDVL
VLTLARTGTHSDLFGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G2T4T1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6L8TBH6 |