Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 3318120..3318685 Replicon chromosome
Accession NZ_LR699011
Organism Roseburia hominis isolate MGYG-HGUT-02517

Toxin (Protein)


Gene name relE Uniprot ID G2T4T1
Locus tag FYB86_RS15420 Protein ID WP_014081142.1
Coordinates 3318395..3318685 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G2T4T0
Locus tag FYB86_RS15415 Protein ID WP_014081141.1
Coordinates 3318120..3318398 (+) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FYB86_RS15375 3313673..3313882 - 210 WP_015514784.1 helix-turn-helix transcriptional regulator -
FYB86_RS15380 3314019..3314177 - 159 WP_014081135.1 membrane protein -
FYB86_RS15385 3314285..3315097 - 813 WP_080633471.1 TraM recognition domain-containing protein -
FYB86_RS15390 3315206..3315571 - 366 WP_014081136.1 hypothetical protein -
FYB86_RS15395 3315649..3315843 - 195 WP_014081137.1 transposon-encoded TnpW family protein -
FYB86_RS15400 3315887..3316750 - 864 WP_014081138.1 ATP-binding protein -
FYB86_RS15405 3316747..3317481 - 735 WP_014081139.1 phage replisome organizer N-terminal domain-containing protein -
FYB86_RS15410 3317595..3317993 - 399 WP_014081140.1 cysteine-rich VLP domain-containing protein -
FYB86_RS15415 3318120..3318398 + 279 WP_014081141.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
FYB86_RS15420 3318395..3318685 + 291 WP_014081142.1 type II toxin-antitoxin system YafQ family toxin Toxin
FYB86_RS15425 3318763..3320208 - 1446 WP_014081143.1 MobA/MobL family protein -
FYB86_RS15430 3320423..3320713 - 291 WP_014081144.1 DUF3847 domain-containing protein -
FYB86_RS15435 3320742..3321203 - 462 WP_009296689.1 sigma-70 family RNA polymerase sigma factor -
FYB86_RS15440 3321214..3321666 - 453 WP_014081145.1 hypothetical protein -
FYB86_RS15445 3321770..3322183 - 414 WP_014081146.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 3322559..3323749 1190


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(6-95)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-70)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11153.97 Da        Isoelectric Point: 9.4307

>T288776 WP_014081142.1 NZ_LR699011:3318395-3318685 [Roseburia hominis]
MRKTKYTVKYTTAFKKDYKRAIKRGLKIELLEQVVALLSMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEEDVL
VLTLARTGTHSDLFGK

Download         Length: 291 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10233.68 Da        Isoelectric Point: 4.4692

>AT288776 WP_014081141.1 NZ_LR699011:3318120-3318398 [Roseburia hominis]
MAGNTTNISIRMDADLKAQADALFTELGMNLTTAFNIFVRQSLREGGIPFEVRLEQPNKETIAAMLEAERIAKDPSVKGY
NDLDELFADLKK

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G2T4T1

Antitoxin

Source ID Structure
AlphaFold DB A0A6L8TBH6

References