288775

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 2265366..2265931 Replicon chromosome
Accession NZ_LR699011
Organism Roseburia hominis isolate MGYG-HGUT-02517

Toxin (Protein)


Gene name relE Uniprot ID C7H6P5
Locus tag FYB86_RS10440 Protein ID WP_002596328.1
Coordinates 2265641..2265931 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C7H6P4
Locus tag FYB86_RS10435 Protein ID WP_005924829.1
Coordinates 2265366..2265644 (+) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FYB86_RS10395 2260507..2260995 - 489 WP_002569239.1 hypothetical protein -
FYB86_RS10400 2261220..2261360 - 141 WP_014080223.1 membrane protein -
FYB86_RS10405 2261456..2262343 - 888 Protein_1995 TraM recognition domain-containing protein -
FYB86_RS10410 2262437..2262802 - 366 WP_014080225.1 hypothetical protein -
FYB86_RS10415 2262880..2263074 - 195 WP_005933543.1 transposon-encoded TnpW family protein -
FYB86_RS10420 2263118..2263981 - 864 WP_005933545.1 ATP-binding protein -
FYB86_RS10425 2263978..2264727 - 750 WP_005933547.1 phage replisome organizer N-terminal domain-containing protein -
FYB86_RS10430 2264841..2265239 - 399 WP_005933550.1 cysteine-rich VLP domain-containing protein -
FYB86_RS10435 2265366..2265644 + 279 WP_005924829.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
FYB86_RS10440 2265641..2265931 + 291 WP_002596328.1 type II toxin-antitoxin system YafQ family toxin Toxin
FYB86_RS10445 2266039..2267484 - 1446 WP_014080226.1 MobA/MobL family protein -
FYB86_RS10450 2267670..2267960 - 291 WP_014080227.1 DUF3847 domain-containing protein -
FYB86_RS10455 2267989..2268450 - 462 WP_014080228.1 sigma-70 family RNA polymerase sigma factor -
FYB86_RS10460 2268461..2268913 - 453 WP_014080229.1 sigma-24 (feci) -
FYB86_RS10465 2269017..2269430 - 414 WP_014080230.1 hypothetical protein -
FYB86_RS10470 2269885..2270346 - 462 WP_044024973.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2232358..2279371 47013


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-94)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-90)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11112.87 Da        Isoelectric Point: 8.0630

>T288775 WP_002596328.1 NZ_LR699011:2265641-2265931 [Roseburia hominis]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK

Download         Length: 291 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10247.66 Da        Isoelectric Point: 4.4692

>AT288775 WP_005924829.1 NZ_LR699011:2265366-2265644 [Roseburia hominis]
MAGNTTNISIRMDADLKAQADALFTELGMNLTTAFNIFVRQSLREGGIPFEVRLEQPNKETVAAMLEAERIAKDPSVKGY
NDLDELFADLKR

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M4XBM1

Antitoxin

Source ID Structure
AlphaFold DB A0A1M4XB19

References