Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 2265366..2265931 | Replicon | chromosome |
| Accession | NZ_LR699011 | ||
| Organism | Roseburia hominis isolate MGYG-HGUT-02517 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C7H6P5 |
| Locus tag | FYB86_RS10440 | Protein ID | WP_002596328.1 |
| Coordinates | 2265641..2265931 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | C7H6P4 |
| Locus tag | FYB86_RS10435 | Protein ID | WP_005924829.1 |
| Coordinates | 2265366..2265644 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYB86_RS10395 | 2260507..2260995 | - | 489 | WP_002569239.1 | hypothetical protein | - |
| FYB86_RS10400 | 2261220..2261360 | - | 141 | WP_014080223.1 | membrane protein | - |
| FYB86_RS10405 | 2261456..2262343 | - | 888 | Protein_1995 | TraM recognition domain-containing protein | - |
| FYB86_RS10410 | 2262437..2262802 | - | 366 | WP_014080225.1 | hypothetical protein | - |
| FYB86_RS10415 | 2262880..2263074 | - | 195 | WP_005933543.1 | transposon-encoded TnpW family protein | - |
| FYB86_RS10420 | 2263118..2263981 | - | 864 | WP_005933545.1 | ATP-binding protein | - |
| FYB86_RS10425 | 2263978..2264727 | - | 750 | WP_005933547.1 | phage replisome organizer N-terminal domain-containing protein | - |
| FYB86_RS10430 | 2264841..2265239 | - | 399 | WP_005933550.1 | cysteine-rich VLP domain-containing protein | - |
| FYB86_RS10435 | 2265366..2265644 | + | 279 | WP_005924829.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| FYB86_RS10440 | 2265641..2265931 | + | 291 | WP_002596328.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| FYB86_RS10445 | 2266039..2267484 | - | 1446 | WP_014080226.1 | MobA/MobL family protein | - |
| FYB86_RS10450 | 2267670..2267960 | - | 291 | WP_014080227.1 | DUF3847 domain-containing protein | - |
| FYB86_RS10455 | 2267989..2268450 | - | 462 | WP_014080228.1 | sigma-70 family RNA polymerase sigma factor | - |
| FYB86_RS10460 | 2268461..2268913 | - | 453 | WP_014080229.1 | sigma-24 (feci) | - |
| FYB86_RS10465 | 2269017..2269430 | - | 414 | WP_014080230.1 | hypothetical protein | - |
| FYB86_RS10470 | 2269885..2270346 | - | 462 | WP_044024973.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2232358..2279371 | 47013 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11112.87 Da Isoelectric Point: 8.0630
>T288775 WP_002596328.1 NZ_LR699011:2265641-2265931 [Roseburia hominis]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M4XBM1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M4XB19 |