Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 1334527..1335017 | Replicon | chromosome |
Accession | NZ_LR699010 | ||
Organism | Lachnoanaerobaculum umeaense isolate MGYG-HGUT-02522 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | FX093_RS06040 | Protein ID | WP_111525019.1 |
Coordinates | 1334748..1335017 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | FX093_RS06035 | Protein ID | WP_111525018.1 |
Coordinates | 1334527..1334751 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FX093_RS06025 | 1333026..1333304 | + | 279 | WP_111525017.1 | hypothetical protein | - |
FX093_RS06030 | 1333295..1334464 | + | 1170 | Protein_1184 | hypothetical protein | - |
FX093_RS06035 | 1334527..1334751 | + | 225 | WP_111525018.1 | antitoxin | Antitoxin |
FX093_RS06040 | 1334748..1335017 | + | 270 | WP_111525019.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FX093_RS06045 | 1335125..1335883 | - | 759 | Protein_1187 | transposase | - |
FX093_RS06050 | 1336043..1336801 | + | 759 | WP_111525939.1 | hypothetical protein | - |
FX093_RS06055 | 1337009..1337365 | + | 357 | WP_111525950.1 | DNA-binding protein | - |
FX093_RS06060 | 1337375..1338730 | + | 1356 | WP_111525940.1 | signal recognition particle protein | - |
FX093_RS06065 | 1338828..1339070 | + | 243 | WP_111525941.1 | 30S ribosomal protein S16 | - |
FX093_RS06070 | 1339083..1339310 | + | 228 | WP_111525942.1 | KH domain-containing protein | - |
FX093_RS06075 | 1339388..1339897 | + | 510 | WP_111525943.1 | ribosome maturation factor RimM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10599.25 Da Isoelectric Point: 10.2260
>T288773 WP_111525019.1 NZ_LR699010:1334748-1335017 [Lachnoanaerobaculum umeaense]
MIYEISTTDKFDKSFKKLDRQAQRILKTWIDKNLMNCDNPRAHGKALSANRSGQWRYRVGDYRILAEIQDNRLVLILIDV
GHRKDIYLF
MIYEISTTDKFDKSFKKLDRQAQRILKTWIDKNLMNCDNPRAHGKALSANRSGQWRYRVGDYRILAEIQDNRLVLILIDV
GHRKDIYLF
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|