Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 1102258..1102808 | Replicon | chromosome |
Accession | NZ_LR699010 | ||
Organism | Lachnoanaerobaculum umeaense isolate MGYG-HGUT-02522 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | FX093_RS04995 | Protein ID | WP_111525534.1 |
Coordinates | 1102527..1102808 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | FX093_RS04990 | Protein ID | WP_111525533.1 |
Coordinates | 1102258..1102524 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FX093_RS04985 | 1097987..1101862 | + | 3876 | WP_111525532.1 | hypothetical protein | - |
FX093_RS04990 | 1102258..1102524 | + | 267 | WP_111525533.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FX093_RS04995 | 1102527..1102808 | + | 282 | WP_111525534.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
FX093_RS05000 | 1102860..1103147 | + | 288 | Protein_978 | BREX-1 system phosphatase PglZ type A | - |
FX093_RS05005 | 1103310..1104563 | + | 1254 | WP_111525535.1 | radical SAM protein | - |
FX093_RS05010 | 1104629..1105978 | + | 1350 | WP_111525536.1 | serpin family protein | - |
FX093_RS05015 | 1106288..1106701 | + | 414 | WP_111525537.1 | hypothetical protein | - |
FX093_RS05020 | 1106881..1107147 | + | 267 | WP_111525538.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 999500..1150023 | 150523 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11104.87 Da Isoelectric Point: 8.7617
>T288772 WP_111525534.1 NZ_LR699010:1102527-1102808 [Lachnoanaerobaculum umeaense]
MKYDVQFTNQFKKDLKLAKKQRKNLDKLFEVIDILANGGTLDAKYRDYDLTGNYKGTRECHIEPNWLLIYEIYDDILVLI
LYRLGTHSELFKK
MKYDVQFTNQFKKDLKLAKKQRKNLDKLFEVIDILANGGTLDAKYRDYDLTGNYKGTRECHIEPNWLLIYEIYDDILVLI
LYRLGTHSELFKK
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|