Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 5377489..5378143 | Replicon | chromosome |
Accession | NZ_LR699009 | ||
Organism | Pluralibacter gergoviae isolate MGYG-HGUT-02520 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A1Y4Y5C6 |
Locus tag | FYC31_RS25420 | Protein ID | WP_043082125.1 |
Coordinates | 5377489..5377896 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A2C5WML2 |
Locus tag | FYC31_RS25425 | Protein ID | WP_043082124.1 |
Coordinates | 5377877..5378143 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYC31_RS25400 | 5373488..5375221 | - | 1734 | WP_043082128.1 | single-stranded-DNA-specific exonuclease RecJ | - |
FYC31_RS25405 | 5375227..5375940 | - | 714 | WP_048254078.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
FYC31_RS25410 | 5375963..5376859 | - | 897 | WP_045289036.1 | site-specific tyrosine recombinase XerD | - |
FYC31_RS25415 | 5376958..5377479 | + | 522 | WP_045289085.1 | flavodoxin FldB | - |
FYC31_RS25420 | 5377489..5377896 | - | 408 | WP_043082125.1 | protein YgfX | Toxin |
FYC31_RS25425 | 5377877..5378143 | - | 267 | WP_043082124.1 | FAD assembly factor SdhE | Antitoxin |
FYC31_RS25430 | 5378391..5379374 | + | 984 | WP_048254077.1 | tRNA-modifying protein YgfZ | - |
FYC31_RS25435 | 5379426..5380268 | + | 843 | WP_086499160.1 | AraC family transcriptional regulator | - |
FYC31_RS25440 | 5380357..5381088 | + | 732 | WP_043082122.1 | AzlC family ABC transporter permease | - |
FYC31_RS25445 | 5381090..5381401 | + | 312 | WP_048254075.1 | AzlD domain-containing protein | - |
FYC31_RS25450 | 5381422..5382576 | + | 1155 | WP_197737250.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15912.73 Da Isoelectric Point: 10.9455
>T288771 WP_043082125.1 NZ_LR699009:c5377896-5377489 [Pluralibacter gergoviae]
VVLWQSDLRVSWRAQWISLLLHGVVAALVLLMPWPLSYTPLWLLLLSLVVFDCVRSQRRINASHGEIKLLTDARLRWQDQ
TWDILGTPWMLESGMMLRLRRLDNRKKSHLWIAADSMDAGEWRDLRRMLQQPSAQ
VVLWQSDLRVSWRAQWISLLLHGVVAALVLLMPWPLSYTPLWLLLLSLVVFDCVRSQRRINASHGEIKLLTDARLRWQDQ
TWDILGTPWMLESGMMLRLRRLDNRKKSHLWIAADSMDAGEWRDLRRMLQQPSAQ
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y4Y5C6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2C5WML2 |