Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 5250095..5250639 | Replicon | chromosome |
Accession | NZ_LR699009 | ||
Organism | Pluralibacter gergoviae isolate MGYG-HGUT-02520 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A379CWM0 |
Locus tag | FYC31_RS24815 | Protein ID | WP_048253394.1 |
Coordinates | 5250364..5250639 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1S2BIB1 |
Locus tag | FYC31_RS24810 | Protein ID | WP_048253393.1 |
Coordinates | 5250095..5250367 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYC31_RS24780 | 5245441..5246544 | - | 1104 | WP_043082210.1 | murein transglycosylase A | - |
FYC31_RS24800 | 5247166..5248419 | - | 1254 | WP_048253392.1 | N-acetylmuramoyl-L-alanine amidase AmiC | - |
FYC31_RS24805 | 5248646..5249977 | + | 1332 | WP_043082208.1 | amino-acid N-acetyltransferase | - |
FYC31_RS24810 | 5250095..5250367 | + | 273 | WP_048253393.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
FYC31_RS24815 | 5250364..5250639 | + | 276 | WP_048253394.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FYC31_RS24820 | 5250645..5252483 | - | 1839 | WP_048253395.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10735.30 Da Isoelectric Point: 9.8862
>T288770 WP_048253394.1 NZ_LR699009:5250364-5250639 [Pluralibacter gergoviae]
MRFQWSVPARNDVVRLHQFLADKNEAATANVVRSLINAPATLLLNPRRGEKIEGFEPREVRRAIIGSYEMHYELQNDVLI
VLRIWHQREDR
MRFQWSVPARNDVVRLHQFLADKNEAATANVVRSLINAPATLLLNPRRGEKIEGFEPREVRRAIIGSYEMHYELQNDVLI
VLRIWHQREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A379CWM0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2BIB1 |