Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 4270512..4271102 | Replicon | chromosome |
| Accession | NZ_LR699009 | ||
| Organism | Pluralibacter gergoviae isolate MGYG-HGUT-02520 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A251ZGU9 |
| Locus tag | FYC31_RS20200 | Protein ID | WP_048252834.1 |
| Coordinates | 4270512..4270844 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A0J5P671 |
| Locus tag | FYC31_RS20205 | Protein ID | WP_048252967.1 |
| Coordinates | 4270845..4271102 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYC31_RS20175 | 4266141..4267031 | + | 891 | WP_043083115.1 | LysR family transcriptional regulator | - |
| FYC31_RS20180 | 4267028..4267963 | - | 936 | WP_045287913.1 | L,D-transpeptidase | - |
| FYC31_RS20185 | 4268056..4269006 | - | 951 | WP_043083111.1 | HTH-type transcriptional regulator Cbl | - |
| FYC31_RS20190 | 4269109..4270026 | - | 918 | WP_043083109.1 | nitrogen assimilation transcriptional regulator NAC | - |
| FYC31_RS20200 | 4270512..4270844 | - | 333 | WP_048252834.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| FYC31_RS20205 | 4270845..4271102 | - | 258 | WP_048252967.1 | antitoxin | Antitoxin |
| FYC31_RS20210 | 4271850..4273253 | + | 1404 | WP_048252966.1 | cytosine permease | - |
| FYC31_RS20215 | 4273267..4274880 | + | 1614 | WP_048252833.1 | GMC family oxidoreductase N-terminal domain-containing protein | - |
| FYC31_RS20220 | 4274938..4275840 | - | 903 | WP_048252832.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11879.77 Da Isoelectric Point: 10.1839
>T288766 WP_048252834.1 NZ_LR699009:c4270844-4270512 [Pluralibacter gergoviae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTMGVIRCDQPRTI
DIAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTMGVIRCDQPRTI
DIAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A251ZGU9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J5P671 |