Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2243067..2243687 Replicon chromosome
Accession NZ_LR699009
Organism Pluralibacter gergoviae isolate MGYG-HGUT-02520

Toxin (Protein)


Gene name Hha Uniprot ID A0A1S2BLN3
Locus tag FYC31_RS10700 Protein ID WP_043085574.1
Coordinates 2243067..2243285 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A089PWG4
Locus tag FYC31_RS10705 Protein ID WP_043085573.1
Coordinates 2243313..2243687 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FYC31_RS10660 2238198..2238413 + 216 WP_045288173.1 hypothetical protein -
FYC31_RS10665 2238426..2239850 - 1425 WP_048253672.1 PLP-dependent aminotransferase family protein -
FYC31_RS25650 2239939..2240553 + 615 WP_048253671.1 membrane protein -
FYC31_RS10675 2240631..2240891 + 261 WP_043085582.1 type B 50S ribosomal protein L31 -
FYC31_RS10680 2240894..2241034 + 141 WP_043085581.1 type B 50S ribosomal protein L36 -
FYC31_RS10685 2241031..2241741 - 711 WP_048253670.1 GNAT family N-acetyltransferase -
FYC31_RS10690 2241801..2242268 - 468 WP_043085577.1 YlaC family protein -
FYC31_RS10695 2242365..2242919 - 555 WP_048253668.1 maltose O-acetyltransferase -
FYC31_RS10700 2243067..2243285 - 219 WP_043085574.1 hemolysin expression modulator Hha Toxin
FYC31_RS10705 2243313..2243687 - 375 WP_043085573.1 Hha toxicity modulator TomB Antitoxin
FYC31_RS10710 2244174..2247323 - 3150 WP_043085571.1 multidrug efflux RND transporter permease subunit -
FYC31_RS10715 2247346..2248530 - 1185 WP_043085568.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-115)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8587.94 Da        Isoelectric Point: 8.9008

>T288759 WP_043085574.1 NZ_LR699009:c2243285-2243067 [Pluralibacter gergoviae]
MSDKALTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.20 Da        Isoelectric Point: 4.5729

>AT288759 WP_043085573.1 NZ_LR699009:c2243687-2243313 [Pluralibacter gergoviae]
MDEYSPKRHDLAQLKFLCETLYHDCLVNLEENGAGWVNDPTAAINLQLNELIEHIATFALNYKIKYNEDDKLIAQIDEYL
DDTFMLFSNYGINADDLQKWRKSGNRLFRCFINASRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1S2BLN3

Antitoxin

Source ID Structure
AlphaFold DB A0A089PWG4

References