Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 1921683..1922403 | Replicon | chromosome |
| Accession | NZ_LR699009 | ||
| Organism | Pluralibacter gergoviae isolate MGYG-HGUT-02520 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A1Y4XQ46 |
| Locus tag | FYC31_RS09130 | Protein ID | WP_045287565.1 |
| Coordinates | 1922005..1922403 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | FYC31_RS09125 | Protein ID | WP_045287566.1 |
| Coordinates | 1921683..1922012 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYC31_RS09115 | 1918044..1919933 | + | 1890 | WP_048253164.1 | pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase | - |
| FYC31_RS09120 | 1920134..1921558 | + | 1425 | WP_043086785.1 | dihydrolipoyl dehydrogenase | - |
| FYC31_RS09125 | 1921683..1922012 | - | 330 | WP_045287566.1 | helix-turn-helix domain-containing protein | Antitoxin |
| FYC31_RS09130 | 1922005..1922403 | - | 399 | WP_045287565.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FYC31_RS09135 | 1922660..1923565 | - | 906 | WP_048253163.1 | LysR family transcriptional regulator | - |
| FYC31_RS09140 | 1923664..1924659 | + | 996 | WP_048253262.1 | aldo/keto reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14899.16 Da Isoelectric Point: 9.7433
>T288758 WP_045287565.1 NZ_LR699009:c1922403-1922005 [Pluralibacter gergoviae]
VRVFRTKLFNKGAKNFQLPDTALFAVAREVFEGRYEANLGGGVIKKRIAINGKGKRGGIRSIIFFKVGSHIFFADTWSKN
DTPKSGKEIDDAQLYAYRLLAETLLNLNDKQLIEMIAKNLLTEVKECEDTDE
VRVFRTKLFNKGAKNFQLPDTALFAVAREVFEGRYEANLGGGVIKKRIAINGKGKRGGIRSIIFFKVGSHIFFADTWSKN
DTPKSGKEIDDAQLYAYRLLAETLLNLNDKQLIEMIAKNLLTEVKECEDTDE
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|