Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 1339995..1340530 | Replicon | chromosome |
Accession | NZ_LR699009 | ||
Organism | Pluralibacter gergoviae isolate MGYG-HGUT-02520 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0J5M2C6 |
Locus tag | FYC31_RS06395 | Protein ID | WP_048253968.1 |
Coordinates | 1339995..1340282 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A089QYF2 |
Locus tag | FYC31_RS06400 | Protein ID | WP_043081737.1 |
Coordinates | 1340279..1340530 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYC31_RS06380 | 1335585..1336271 | - | 687 | WP_048254039.1 | sel1 repeat family protein | - |
FYC31_RS06385 | 1336524..1338671 | - | 2148 | WP_080732634.1 | formate dehydrogenase subunit alpha | - |
FYC31_RS06390 | 1338969..1339904 | + | 936 | WP_048253969.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
FYC31_RS06395 | 1339995..1340282 | - | 288 | WP_048253968.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FYC31_RS06400 | 1340279..1340530 | - | 252 | WP_043081737.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
FYC31_RS06405 | 1340621..1341307 | - | 687 | WP_043081738.1 | DNA-binding transcriptional regulator CsiR | - |
FYC31_RS06410 | 1341335..1342735 | - | 1401 | WP_048253967.1 | GABA permease | - |
FYC31_RS06415 | 1342865..1344148 | - | 1284 | WP_106912783.1 | 4-aminobutyrate--2-oxoglutarate transaminase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11093.04 Da Isoelectric Point: 10.5481
>T288757 WP_048253968.1 NZ_LR699009:c1340282-1339995 [Pluralibacter gergoviae]
MSYRIKFREDALKEWNRLDKVIQQQFAKKLKKCSEDPHIPAAKLRGMPNCYKIKLRSAGFRLVYQVIDDALIVAVVAVGK
REREDVYARAGDRIR
MSYRIKFREDALKEWNRLDKVIQQQFAKKLKKCSEDPHIPAAKLRGMPNCYKIKLRSAGFRLVYQVIDDALIVAVVAVGK
REREDVYARAGDRIR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J5M2C6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A089QYF2 |