Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 1223932..1224485 | Replicon | chromosome |
| Accession | NZ_LR699009 | ||
| Organism | Pluralibacter gergoviae isolate MGYG-HGUT-02520 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A379CUA0 |
| Locus tag | FYC31_RS05840 | Protein ID | WP_048254026.1 |
| Coordinates | 1224171..1224485 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | FYC31_RS05835 | Protein ID | WP_048254027.1 |
| Coordinates | 1223932..1224168 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYC31_RS05810 | 1219337..1220968 | + | 1632 | WP_043081630.1 | Na/Pi cotransporter family protein | - |
| FYC31_RS05815 | 1221006..1221818 | - | 813 | WP_048254029.1 | shikimate 5-dehydrogenase | - |
| FYC31_RS05820 | 1222046..1222918 | + | 873 | WP_043081632.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| FYC31_RS05825 | 1223128..1223466 | + | 339 | WP_080964540.1 | helix-turn-helix domain-containing protein | - |
| FYC31_RS05830 | 1223467..1223739 | - | 273 | WP_048254028.1 | DUF3811 domain-containing protein | - |
| FYC31_RS05835 | 1223932..1224168 | + | 237 | WP_048254027.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| FYC31_RS05840 | 1224171..1224485 | + | 315 | WP_048254026.1 | CcdB family protein | Toxin |
| FYC31_RS05845 | 1224530..1225453 | - | 924 | WP_048254025.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| FYC31_RS05850 | 1225560..1227143 | - | 1584 | WP_048254024.1 | RNA repair transcriptional activator RtcR | - |
| FYC31_RS05860 | 1227590..1228717 | + | 1128 | WP_048254023.1 | slipin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11520.48 Da Isoelectric Point: 6.7131
>T288755 WP_048254026.1 NZ_LR699009:1224171-1224485 [Pluralibacter gergoviae]
MQFTVYGNTGKSAVYPLLIDVTSDIIGQLNRHIAIPLLPLEKYPASQRPERLIPLIRLSDGKEYAVMTHEMASIPVSVLG
PVFCDASHYRPQIKAAIDFLLDGI
MQFTVYGNTGKSAVYPLLIDVTSDIIGQLNRHIAIPLLPLEKYPASQRPERLIPLIRLSDGKEYAVMTHEMASIPVSVLG
PVFCDASHYRPQIKAAIDFLLDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|