Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 811688..812304 | Replicon | chromosome |
Accession | NZ_LR699009 | ||
Organism | Pluralibacter gergoviae isolate MGYG-HGUT-02520 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | FYC31_RS03780 | Protein ID | WP_106912772.1 |
Coordinates | 811688..812059 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1S2BMV8 |
Locus tag | FYC31_RS03785 | Protein ID | WP_043081486.1 |
Coordinates | 812062..812304 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYC31_RS03765 | 808925..809827 | + | 903 | WP_043081490.1 | formate dehydrogenase subunit beta | - |
FYC31_RS03770 | 809824..810459 | + | 636 | WP_043081489.1 | formate dehydrogenase cytochrome b556 subunit | - |
FYC31_RS03775 | 810731..811660 | + | 930 | WP_043081488.1 | formate dehydrogenase accessory protein FdhE | - |
FYC31_RS03780 | 811688..812059 | - | 372 | WP_106912772.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
FYC31_RS03785 | 812062..812304 | - | 243 | WP_043081486.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
FYC31_RS03790 | 812441..812731 | - | 291 | WP_043081485.1 | helix-turn-helix domain-containing protein | - |
FYC31_RS03795 | 812979..813920 | - | 942 | WP_043081484.1 | fatty acid biosynthesis protein FabY | - |
FYC31_RS03800 | 813953..814390 | - | 438 | WP_043081483.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
FYC31_RS03805 | 814387..815250 | - | 864 | WP_043081482.1 | virulence factor BrkB family protein | - |
FYC31_RS03810 | 815255..815845 | - | 591 | WP_048254743.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13443.48 Da Isoelectric Point: 9.9871
>T288754 WP_106912772.1 NZ_LR699009:c812059-811688 [Pluralibacter gergoviae]
MDGPAVFDTNILIDLFNNRSEAANAIEQRGPHRAVSLVTWMEVMAGAKKYGQEARTAGVFSLFEVVDINKEIARRSVSLR
ATYGMKLPDAIILATAQARGSALITRNTKDFAGIPGVITPYRF
MDGPAVFDTNILIDLFNNRSEAANAIEQRGPHRAVSLVTWMEVMAGAKKYGQEARTAGVFSLFEVVDINKEIARRSVSLR
ATYGMKLPDAIILATAQARGSALITRNTKDFAGIPGVITPYRF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|