Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 121228..121816 | Replicon | chromosome |
Accession | NZ_LR699009 | ||
Organism | Pluralibacter gergoviae isolate MGYG-HGUT-02520 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | FYC31_RS00580 | Protein ID | WP_064360548.1 |
Coordinates | 121228..121584 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1S2BDS7 |
Locus tag | FYC31_RS00585 | Protein ID | WP_043080699.1 |
Coordinates | 121574..121816 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYC31_RS00560 | 116557..117336 | - | 780 | WP_043080695.1 | acetolactate decarboxylase | - |
FYC31_RS00565 | 117443..118330 | + | 888 | WP_048254367.1 | LysR family transcriptional regulator | - |
FYC31_RS00570 | 118688..120826 | + | 2139 | WP_048254369.1 | anaerobic ribonucleoside-triphosphate reductase | - |
FYC31_RS00575 | 120826..121290 | + | 465 | WP_043080698.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
FYC31_RS00580 | 121228..121584 | - | 357 | WP_064360548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FYC31_RS00585 | 121574..121816 | - | 243 | WP_043080699.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
FYC31_RS00590 | 121895..123805 | - | 1911 | WP_048254371.1 | BglG family transcription antiterminator | - |
FYC31_RS00595 | 123823..124968 | - | 1146 | WP_048254373.1 | lactonase family protein | - |
FYC31_RS00600 | 125030..125770 | - | 741 | WP_043080703.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13598.09 Da Isoelectric Point: 10.8127
>T288752 WP_064360548.1 NZ_LR699009:c121584-121228 [Pluralibacter gergoviae]
MIYELVFDPRALKEWHKLGDTVRAQFKKKLAEVLCQPRQTSARLRGLPDCYKIKLKSSGYRLVYQVQDEKITVLVIAIGK
RERAAVYKDAGRRVNSLPLAQLMHNLITAPPPNQRRVL
MIYELVFDPRALKEWHKLGDTVRAQFKKKLAEVLCQPRQTSARLRGLPDCYKIKLKSSGYRLVYQVQDEKITVLVIAIGK
RERAAVYKDAGRRVNSLPLAQLMHNLITAPPPNQRRVL
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|