Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
| Location | 2294962..2295756 | Replicon | chromosome |
| Accession | NZ_LR699008 | ||
| Organism | Hafnia alvei isolate MGYG-HGUT-02508 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | FYB81_RS10670 | Protein ID | WP_096387615.1 |
| Coordinates | 2295235..2295756 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | A0A097R2F1 |
| Locus tag | FYB81_RS10665 | Protein ID | WP_025801385.1 |
| Coordinates | 2294962..2295231 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYB81_RS10650 | 2290560..2291591 | - | 1032 | WP_043493238.1 | Mal regulon transcriptional regulator MalI | - |
| FYB81_RS10655 | 2291842..2293437 | + | 1596 | WP_111329514.1 | maltose/glucose-specific PTS transporter subunit IIBC | - |
| FYB81_RS10660 | 2293521..2294696 | + | 1176 | WP_025801384.1 | pyridoxal phosphate-dependent aminotransferase | - |
| FYB81_RS10665 | 2294962..2295231 | + | 270 | WP_025801385.1 | DUF1778 domain-containing protein | Antitoxin |
| FYB81_RS10670 | 2295235..2295756 | + | 522 | WP_096387615.1 | GNAT family N-acetyltransferase | Toxin |
| FYB81_RS10675 | 2295954..2296952 | + | 999 | WP_103009725.1 | adenosine deaminase | - |
| FYB81_RS10680 | 2297550..2298545 | - | 996 | WP_111329516.1 | bile acid:sodium symporter | - |
| FYB81_RS10685 | 2298707..2299750 | - | 1044 | WP_111329518.1 | oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19412.24 Da Isoelectric Point: 6.9676
>T288744 WP_096387615.1 NZ_LR699008:2295235-2295756 [Hafnia alvei]
MPDLTIAIFSSEAEYDFSDFDCGEESLNVFLTDHLARQHNARILRGYLLITQTLKPKVVGYYTLSGSCFEKETLPSNTQK
RKVPYVNVPSITLGRLAIQKDLHGQEWGTALVTHAMQVVYRASLAVGVHGMFVDALNEKAKQFYLKLGFIALTGNNANSL
FYPTKSIEKLFED
MPDLTIAIFSSEAEYDFSDFDCGEESLNVFLTDHLARQHNARILRGYLLITQTLKPKVVGYYTLSGSCFEKETLPSNTQK
RKVPYVNVPSITLGRLAIQKDLHGQEWGTALVTHAMQVVYRASLAVGVHGMFVDALNEKAKQFYLKLGFIALTGNNANSL
FYPTKSIEKLFED
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|