Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 738439..739099 | Replicon | chromosome |
Accession | NZ_LR699008 | ||
Organism | Hafnia alvei isolate MGYG-HGUT-02508 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A377PEM3 |
Locus tag | FYB81_RS03475 | Protein ID | WP_043490966.1 |
Coordinates | 738686..739099 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A097QZ09 |
Locus tag | FYB81_RS03470 | Protein ID | WP_025801623.1 |
Coordinates | 738439..738705 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYB81_RS03450 | 733707..734357 | - | 651 | WP_025801627.1 | hemolysin III family protein | - |
FYB81_RS03455 | 735018..735902 | + | 885 | WP_043490960.1 | nucleoside-specific channel-forming protein Tsx | - |
FYB81_RS03460 | 736104..736922 | + | 819 | WP_043490961.1 | shikimate 5-dehydrogenase | - |
FYB81_RS03465 | 737071..738060 | - | 990 | WP_043490963.1 | tRNA-modifying protein YgfZ | - |
FYB81_RS03470 | 738439..738705 | + | 267 | WP_025801623.1 | FAD assembly factor SdhE | Antitoxin |
FYB81_RS03475 | 738686..739099 | + | 414 | WP_043490966.1 | protein YgfX | Toxin |
FYB81_RS03480 | 739186..739704 | - | 519 | WP_040046181.1 | flavodoxin FldB | - |
FYB81_RS03485 | 739909..740808 | + | 900 | WP_043491009.1 | site-specific tyrosine recombinase XerD | - |
FYB81_RS03490 | 740836..741552 | + | 717 | WP_025801619.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
FYB81_RS03495 | 741558..743291 | + | 1734 | WP_043490968.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16198.93 Da Isoelectric Point: 8.1501
>T288743 WP_043490966.1 NZ_LR699008:738686-739099 [Hafnia alvei]
VDQWRCDVRVSWRTQLLLLVTHGILILLILLAPWPENYSFYWLVLLTLVVFECIRSQKQIAKIQGEFSFLADNHIQWQQN
EWELCKTPWISDFGALLPLRSVKPQGTKKRLWIAADSLTPEAWCHLRRTLMQTHQSD
VDQWRCDVRVSWRTQLLLLVTHGILILLILLAPWPENYSFYWLVLLTLVVFECIRSQKQIAKIQGEFSFLADNHIQWQQN
EWELCKTPWISDFGALLPLRSVKPQGTKKRLWIAADSLTPEAWCHLRRTLMQTHQSD
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A377PEM3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A097QZ09 |